KEGG   Burkholderia pseudomallei BPC006: BPC006_II2752Help
Entry
BPC006_II2752     CDS       T02301                                 

Definition
fatty acid desaturase family protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BPC006_II2752
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BPC006_II2752
Enzymes [BR:bpq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BPC006_II2752
Lipid biosynthesis proteins [BR:bpq01004]
 Desaturase
  First
   BPC006_II2752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:2770758..2771798
Genome map
AA seq 346 aa AA seqDB search
MKHASAESPDSAGCAETPARAPAGSAADTAAPPAPDERASGHLSRASSARHLGVAALPAA
GTAAAIALWAGFGLAPRVQDIAMLAVFYVLNILGMELALHRYFAHRTFKAKPAVKIALAI
LGSLAYMGPLMWWVAIHRLHHANADRPGDPHTPQLGGRGFAGRAKGILHGHVGWLFDPSS
ARPKGWNQYANDMYRDPTLLRIHLAYDYWLLLGLLLPGALGWLLDPSWRGALLGLLWGGT
VRIFLATNAIWAVNSIGHALGGRRPFPGRDQSRNAAWLALVTLGAGWHNNHHAFPQYAST
RLTRWQIDVTGMLIALLERLGLVWDVQHPDRDAVRERLANARRDDA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacgcgagcgccgagagccccgatagcgccggctgcgccgagacgccggcgcgc
gcgccggccggctcggcggcggatacggccgccccgcccgcgcccgacgagcgcgcctcc
ggccatctgtcgcgcgcgtcgtccgcgcgccatctgggcgtcgcggcgctgcccgccgcc
ggcacggccgccgcgatcgcgctctgggccgggttcggcctcgcgccgcgcgtgcaggac
atcgccatgctcgcggtcttctacgtgctcaacattctcggcatggagctcgcgctgcac
cgctatttcgcgcatcgcacgttcaaggcgaagccggccgtgaagatcgcgctcgcgatc
ctcggctcgctcgcgtacatggggccgctgatgtggtgggtggcgatccaccggctgcat
cacgcgaacgccgaccggccgggcgacccgcacacgccgcaactcggcgggcgcggcttc
gccggccgcgcgaagggcatcctgcacgggcacgtcggctggctgttcgatccgtcgtcc
gcgcgcccgaagggctggaaccaatatgcgaacgacatgtaccgcgacccgacgctgctg
cgcatccatctcgcgtacgactactggctgctgctcggcctgctgctgccgggcgcgctc
ggctggctgctcgatccttcgtggcggggcgcgctgctcggcctgctgtggggcggcacc
gtgcggatctttctcgcgacgaacgcgatctgggcggtcaattcgatcggccacgcgctc
ggcggccggcggccgtttcccggccgcgaccagagccgcaacgcggcgtggctcgcgctc
gtcacgctcggcgcgggctggcacaacaaccatcacgcgtttccgcagtatgcgagcacg
cgcctgacccgctggcagatcgacgtgaccggcatgctgatcgcgctgcttgaacggctg
ggcctcgtgtgggacgttcagcacccggaccgggacgcggtgcgcgagcggctcgcgaac
gcacggcgcgacgacgcgtag

DBGET integrated database retrieval system