KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0112Help
Entry
GBP346_A0112      CDS       T00894                                 

Definition
lipid A biosynthesis lauroyl acyltransferase
Orthology
K02517  
lipid A biosynthesis lauroyl acyltransferase [EC:2.3.1.-]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    GBP346_A0112
Enzymes [BR:bpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     GBP346_A0112
Lipopolysaccharide biosynthesis proteins [BR:bpr01005]
 Lipid A
  GBP346_A0112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(98081..98965)
Genome map
AA seq 294 aa AA seqDB search
MLGRLGTRLAVAFLKFLAVLPYGLTARLGDGLGWLLYRIPSRRKRIVHINLQLCFPDWSD
ARREEIAGRHFRHAIRSYVERSVQWFGSAKKLEKLIQVDSAIDLTDPNLPPTLFLGLHFV
GIEAGSIWLNRSLQRRCGSLYQPFSNPTLEAIAKAARGRFDAEMVGRADSARVVLRWLRD
RKPVMLGADMDYGLRNSTFVPFFGVPACTLTAVGRLARTGHAQVVPFIGEVLPDYQGYRL
KVFKPWENYPTGDDDLDARRMNAFLEEQIPLMPEQYYWVHKRFKTRPPGEPGVY
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgctaggccgtctcggcacacggcttgccgtcgcgtttctcaaattcctcgcggtcctg
ccgtacgggctgaccgcgcgcctgggcgacggcctcggctggctgctctatcggatcccc
agccggcgcaagcgcatcgtacacatcaatctgcaactctgctttcccgattggagcgac
gcgcgccgcgaggaaatcgccgggcggcacttccggcacgcgatccgcagctacgtcgag
cgcagcgtccagtggttcggctccgcgaaaaagctcgaaaaattgatccaggtcgacagc
gcgatcgatctcaccgacccgaacctgccgccgacgctcttcctcgggctgcacttcgtc
ggcatcgaggcgggctcgatctggctgaaccgctcgctgcaacgccgctgcggctcgctg
taccagccgttctcgaacccgacgctcgaagccatcgcgaaagccgcgcgcggccgcttc
gacgccgagatggtcggccgcgccgacagcgcgcgcgtcgtgctgcgctggctgcgcgac
cgcaagccggtgatgctcggcgccgacatggattacggcctgcgcaactcgacgttcgtg
ccgttcttcggcgtgcctgcgtgcacgctgaccgcggtcggccggctcgcgaggacaggc
catgcgcaggtcgtgccgttcatcggcgaagtgctgcccgattaccagggttatcggctg
aaagtcttcaaaccttgggaaaattatccgacgggcgacgacgacctcgacgcgcgccgg
atgaacgcgttcctcgaggagcagattccgctgatgcccgagcagtactactgggtgcac
aaacgcttcaagacgcgcccgcccggcgagccgggcgtctactga

DBGET integrated database retrieval system