KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0309Help
Entry
GBP346_A0309      CDS       T00894                                 

Definition
alkaline phosphatase family protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GBP346_A0309
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    GBP346_A0309
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GBP346_A0309
Enzymes [BR:bpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     GBP346_A0309
Exosome [BR:bpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GBP346_A0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:266486..267925
Genome map
AA seq 479 aa AA seqDB search
MKRVRLAALLGASVFAAAGCGSDEPKTPGASDNGAQTGAARNVIFFLGDGMGMTTLTAAR
IYALGEDGALTLDTLPETAFVKTYSNDAQVTDSAPSMSAYMTGVKTNNEVISMTPDTKAI
EPSASLTGNCGANNGKPVPTLLEIAKAKGLATGVVTTTRVTHATPAATYAHVCHRDAEND
IAAQLVPGGAGYNAALGGGVDVVLGGGAQFFVPKEAGGKRADGRHLVNELKAKGYAIAQN
RDELLAADATKRGKLAGLFASSHMSYDLDRGATKEPSLADMATRALDVLQKNPNGYFLMV
EGGRIDHALHDTNAKRALQDTVAFDNAIKATLDKVRQTDPELKNTLVVVTADHDHTLVLN
GYAARTGKTEAGKPGVLGVLRNYQTGAVAKDADGAPYTIIGFGNGEKRVQGSRAGTSLTD
AVTGADDYRQEAVVRMAKGGETHGGTDVFLGAIGRGADGFHGVIENNKVFELVRGAAQL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgagtgagactggccgcgctccttggcgcgagcgtcttcgcggcggcgggctgc
ggcagcgacgagccgaagacgccgggcgcatcggacaacggcgcgcagacgggcgccgcg
cgcaacgtcatcttctttctgggcgacggaatggggatgacgacgctcacggccgcgcga
atctatgcgctcggcgaggacggcgcgctcacgctcgacacgctgcccgagaccgcgttc
gtgaagacctattcgaacgatgcgcaggtgacggacagcgcgccgtcgatgtccgcatat
atgacgggcgtgaagacgaacaacgaagtgatctcgatgacgcccgacacgaaggcgatc
gagccgagcgcgagtctcaccggcaactgcggcgcgaacaacggcaagccggtgccgacg
ctgctcgagatcgcgaaggcgaaggggctcgccaccggcgtcgtgacgacgacccgcgtc
acccacgcgacgcccgccgcgacctacgcgcacgtgtgccaccgcgacgccgagaacgac
atcgccgcgcagctcgtgccgggcggcgcgggctacaacgcggcgctcggcggcggcgtg
gatgtcgtgctgggcggcggcgcgcaattcttcgtgccgaaggaagcgggcggcaagcgc
gcggacggccgccatctcgtgaacgagctgaaggcgaagggctacgcgatcgcgcagaac
cgcgacgagctcctcgccgccgatgcgacgaagcgcggcaagctcgcgggcctgttcgcg
tcgagccacatgagctacgacctcgaccgcggcgcgacgaaagagccgagcctcgccgac
atggcgacgcgcgcgctcgacgtgctgcagaagaacccgaacggctatttcctgatggtc
gaaggcgggcgcatcgatcacgcgctgcacgacacgaacgcgaagcgcgcgctgcaggat
acggtcgcgttcgacaacgcgatcaaggcgacgctcgacaaggtgcgccagaccgatccg
gagctgaagaacacgctcgtcgtcgtgacggccgaccacgatcacacgctggtgctcaac
ggctacgcggcgcgcacgggcaagacggaagcgggcaagccgggcgtgctcggcgtgctg
cgcaactatcagacgggcgcggtcgcgaaggacgcggacggcgcgccgtacacgatcatc
ggcttcggcaacggcgagaaacgcgtgcaaggcagccgcgcgggcacgagcctcaccgac
gcggtgacgggcgcggacgattatcgccaggaagcggtcgtgcgcatggccaagggcggc
gagacgcacggcggcaccgacgtgttcctcggcgcgatcggccgcggcgcggacggcttt
cacggcgtgatcgagaacaacaaggtgttcgagctcgtgcgcggcgcggcgcagctctga

DBGET integrated database retrieval system