KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0310Help
Entry
GBP346_A0310      CDS       T00894                                 

Definition
alkaline phosphatase family protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bpr00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bpr00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bpr02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:267958..269361
Genome map
AA seq 467 aa AA seqDB search
MSTIKRIAAAAFAAAALSGGFGHAAHAAGQAKNVIFFLGDGMGPATVTASRLYKVGEAGQ
LTMEKLPRTARIKTFSNDAQTTDSAPSMAAYMTGVKMNNEVLSMSPDTRAIAPGSDANGN
KTVNRCGVGNGTPAATLLELAKARGKAVGAITTTELTHATPAATYSHICHRDAQYDIAAQ
AVPGGAGYNAALGDGVDVLMGGGRNHWTPYDPLANRRGRADGRNLLAELQAKGYAVVATK
DQLAQAGAGKLIGLFSTTSHLEYELDRVAGKGEGATQPSLSEMTAKAIDVLRKNPNGYFL
MVEGGRIDHALHGTNAKRALEDTVAFDEAIRTALAKVDLSDTLIVVTADHDHTMTINGYS
KRGNPVLDISRNYRDGQPNKDADGNPYTTLVFGNGANRPNVRVPVDSSTATNDAYLQEVG
VRMGSAGSETHGGGDVMLFADGAGAKAFKGTLDNTKVFGLVKAAFGF
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactatcaagcgcatcgcggcggcggcgttcgccgcggcggccctctcgggcggt
ttcggccacgcggcgcacgccgcgggccaggcgaagaacgtgatcttcttcctcggcgac
gggatggggccggccaccgtgacggcgagccgcctctacaaggtcggcgaagccggccaa
ctgacgatggaaaagctgccgcgcaccgcgcgcatcaagaccttctcgaacgacgcgcag
acgacggacagcgcgccgtcgatggccgcgtacatgaccggcgtgaagatgaacaacgag
gtgctgtcgatgtcgccggacacgcgcgcgatcgcccccggcagcgacgcgaacggcaac
aagacggtgaaccgctgcggcgtgggcaacggcacgccggcggcgacgctgctcgagctc
gcgaaggcgcgcggcaaggcggtcggcgcgatcacgacgaccgagctcacgcacgcgacg
cccgcggcgacctactcgcacatctgccatcgcgacgcgcagtacgacattgccgcgcag
gccgtgccgggcggcgcgggctacaacgcggcgctcggcgacggcgtcgacgtgctgatg
ggcggcggccgcaatcattggacgccgtacgatccgctcgccaacaggcgcggccgcgcg
gacgggcgcaacctgctcgccgagctgcaggcgaagggctacgcggtggtcgcgacgaag
gatcagctcgcgcaggcgggcgcgggcaagctgatcggccttttcagcacgacgagccat
ctcgaatacgagctcgaccgcgtcgcgggcaagggcgagggcgcgacgcagccgagcctc
tcggagatgaccgcgaaggcgatcgacgtgttgcggaagaatccgaacggctatttcctg
atggtcgaaggcgggcgcatcgaccacgcgctgcacggcacgaacgcgaagcgcgcgctc
gaagacacggtggcgttcgacgaggcgatccgcaccgcgctcgcgaaggtcgatctgtcg
gatacgctgatcgtcgtgacggccgatcacgatcacacgatgacgatcaacggctattcg
aagcgcggcaatccggtgctcgacatcagccgcaactatcgcgacggccagccgaacaag
gacgcggacggcaacccgtacacgacgctcgtgttcggcaatggcgcgaaccggccgaac
gtgcgcgtgccggtggattcgtcgacggcgacgaacgacgcgtatctgcaggaagtcggc
gtgcgcatgggcagcgcgggttccgagacgcacggcggcggcgacgtgatgctgtttgcc
gacggcgccggcgcgaaggcgttcaagggcacgctcgacaacacgaaggtgttcggcctc
gtgaaggccgcattcgggttctga

DBGET integrated database retrieval system