KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0347Help
Entry
GBP346_A0347      CDS       T00894                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr00071  Fatty acid degradation
bpr00280  Valine, leucine and isoleucine degradation
bpr00281  Geraniol degradation
bpr00310  Lysine degradation
bpr00360  Phenylalanine metabolism
bpr00362  Benzoate degradation
bpr00380  Tryptophan metabolism
bpr00410  beta-Alanine metabolism
bpr00627  Aminobenzoate degradation
bpr00640  Propanoate metabolism
bpr00650  Butanoate metabolism
bpr00903  Limonene and pinene degradation
bpr00930  Caprolactam degradation
bpr01100  Metabolic pathways
bpr01110  Biosynthesis of secondary metabolites
bpr01120  Microbial metabolism in diverse environments
bpr01130  Biosynthesis of antibiotics
bpr01212  Fatty acid metabolism
Module
bpr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GBP346_A0347
   00650 Butanoate metabolism
    GBP346_A0347
  Lipid metabolism
   00071 Fatty acid degradation
    GBP346_A0347
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GBP346_A0347
   00310 Lysine degradation
    GBP346_A0347
   00360 Phenylalanine metabolism
    GBP346_A0347
   00380 Tryptophan metabolism
    GBP346_A0347
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GBP346_A0347
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GBP346_A0347
   00281 Geraniol degradation
    GBP346_A0347
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GBP346_A0347
   00627 Aminobenzoate degradation
    GBP346_A0347
   00930 Caprolactam degradation
    GBP346_A0347
Enzymes [BR:bpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GBP346_A0347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACQ96814
UniProt: C4KNS5
Position
I:303440..304267
Genome map
AA seq 275 aa AA seqDB search
MTDLALYAGYEALRIQRRPHGIVEIVMSGEGANRSGLAVASEAMHRELADIWRDVDRDPD
ARVAVIRGEGKGFSAGGDLALVERMADDHAVRERVWREARDLVYNVINCSKPIVSAMHGP
AVGAGLVAGLLADVSIAAKHARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYHLLLCEP
VSGEEAERIGLVSLALDDHELLPKAYEIAERLAQGSQSAIRWTKYALNNWLRLAGPTFDA
SLALEFMGFSGPDVREGIRSLRERRAPDFTGGAPS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcgctctttatgccggctatgaagcgctgcgcatccagcgccggccgcac
ggcatcgtcgaaatcgtgatgagcggcgaaggcgcgaaccgcagcggcctcgcggtcgcg
agcgaggcgatgcaccgcgagctcgccgatatctggcgcgacgtcgaccgcgatcccgac
gcgcgcgtcgcggtgatccgcggcgaaggcaagggcttctcggcgggcggcgatctcgcg
ctcgtcgagcgcatggccgacgatcacgcggtgcgcgagcgcgtctggcgcgaagcgcgc
gatctcgtctacaacgtgatcaattgcagcaagccgatcgtgtcggcgatgcacgggccg
gccgtcggcgccgggctcgtcgccgggctgctcgccgacgtgtcaatcgccgcgaagcac
gcgcggatcatcgacgggcacacgcgtctcggcgtcgccgcgggcgatcacgcggcgatc
gtctggccgctgctctgcgggatggcgaaggcgaaataccacctgctcctctgcgagccc
gtgagcggcgaggaggccgagcgcatcgggctcgtgtcgctcgcgctcgacgatcacgag
ctgctgccgaaggcgtacgagatcgccgagcgcctcgcgcaaggctcgcaaagcgcgatc
cgctggaccaagtacgcgctcaacaactggctgcggctggccgggccgaccttcgacgcg
tcgctcgcgctcgaattcatgggtttttccgggccggacgtgcgcgaaggcattcgctcg
ctgcgcgagcgccgcgcgccggatttcacgggcggcgcgccgtcttga

DBGET integrated database retrieval system