KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0501Help
Entry
GBP346_A0501      CDS       T00894                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bpr03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:457141..457971
Genome map
AA seq 276 aa AA seqDB search
MPELPEVEVTRRGIEPFVAGRRVERVDVRTAMLRWPVPVGFAEMLRSREVLRVERRGKYL
LFEVDAGWFIVHLGMTGTLRVLPNDAPPPAPAKHDHVDWIFDEFVLRFRDPRRFGAVLWH
PRDAGDVHAHPLLASLGVEPFSAAFSGALLFGRTRGRTVSVKQALLAGDIVVGVGNIYAS
ESLFRAGIRPTTAAGRVSLPRYERLADAVRATLADAIERGGSTLRDFVGSNGESGYFQLD
CFVYDRAGEPCRVCGAPIRQIVQGQRSTYFCPNCQR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgccagagttgccggaagtcgaggttacgcgccggggcatcgagccgttcgtcgccggg
cggcgcgtcgagcgcgtcgacgtgcgcaccgccatgctgcgctggcccgtgcccgtcggc
ttcgccgagatgctccgatcgcgcgaggtgctgcgcgtcgagcggcgcggcaagtatctg
ctgttcgaagtcgacgccggctggttcatcgtccatctcggcatgacgggcacgctgcgc
gtgttgccgaacgacgcgccgccgcccgcgccggcgaagcacgatcacgtcgactggatt
ttcgacgaattcgtgctgcgctttcgcgatccgcgccgtttcggcgcggtgctctggcat
ccgcgcgacgcgggcgacgtgcacgcgcatccgctgctcgcgagcctcggtgtcgagccg
ttctcggccgcgttctcgggcgcgctcctcttcggccgcacgcgcgggcgtacggtgtcc
gtcaagcaggcgctgctcgcgggcgacatcgtcgtcggcgtcggcaacatctatgcgtcc
gagagcctctttcgcgcgggcatccggccgaccacggcggcggggcgcgtatcgctgccg
cgctacgagcggctcgccgacgcggtgcgcgcgacgctcgccgacgcgatcgagcgcggc
ggcagcacgctgcgcgacttcgtcggcagcaacggcgagagcggctatttccagctcgac
tgcttcgtctacgatcgcgcgggcgagccgtgccgcgtctgcggcgcgccgatccgccag
atcgtccaggggcagcgatccacctatttctgtccgaattgtcagcgttaa

DBGET integrated database retrieval system