KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0649Help
Entry
GBP346_A0649      CDS       T00894                                 

Gene name
asnB_1
Definition
asparagine synthase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bpr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(609231..610763)
Genome map
AA seq 510 aa AA seqDB search
MCGIGAIFSTQRASVDGIERSLSALMSKIAHRGDASRFNENLIRERFGLATNRLAIVERD
HARQPVSDHERDLHVVLNGQIYNYKELRDELAARGHRFSHAGDAEVLLRAYLEYGPSFAT
KLDGMFSFVLFDNLNGKFLIGRDHVGIKPLYYAQRDGVWYVASELKALTHVNARIETLAP
GTLFDGKETIRYVSYDASRPVSRDSFDEAKARVRTLLEESVRRRVDTDLPICVMFSGGID
SAIVLRLAHRYHPDVTAISFGLPGSNDIEIAHRYCAEHGIRHVIYTFTKQDLLENIDDAV
YYGEFFEKIDAIDSAIAHFGYYIANKLGLKVALCGEGSDEIFGGYDLFKTHAQPGALSLY
RLNNLHRTDLQRVDRASMRNTVEARVPFMDAELIDYVLSLDFSYKLHGGVEKHILREAFR
DVLPGYIIDRPKIRMPDGSGVKNVIIDHIDSLGDAPPDDAARRLGEIGLSDRSALFFARK
YLECNFPFPTQRFKQAGKDFSESGYFDFIS
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattggggccattttcagcacgcagcgcgcgtcggtcgacggcatcgagcgc
tcgctgagcgcgttgatgtcgaagatcgcgcaccgcggcgacgcgtcgcgcttcaacgaa
aacctgatccgggagcgcttcggcctcgcgacgaaccgcctcgcgatcgtcgagcgcgac
catgcgcgccaaccggtgtccgatcacgagcgcgacctgcacgtcgtgctcaacgggcag
atctacaactacaaggaactgcgcgacgagctcgccgcgcgcggccaccgcttcagccat
gcgggcgacgccgaggtgctgttgcgcgcgtacctcgagtacggcccgtcgttcgcgacg
aagctcgacggcatgttcagcttcgtgctgttcgacaacctgaacggaaaattcctgatc
gggcgcgaccacgtcggcatcaagccgctctattacgcgcagcgcgacggcgtctggtac
gtcgcgtcggaactcaaggcgctcacgcacgtgaacgcgcgaatcgagacgctcgcgccc
ggcacgctgttcgacggcaaggagacgatcaggtacgtgtcgtacgacgccagccgcccg
gtgagccgcgacagcttcgacgaagcgaaggcgcgcgtgcgcacgctgctcgaggaatcg
gtgcgccgccgcgtcgacaccgacctgccgatctgcgtgatgttcagcggcggcatcgac
agcgcgatcgtgctgcggctcgcgcaccgctatcacccggacgtgaccgcgatctcgttc
ggcctgcccggctcgaacgacatcgagatcgcgcaccgctactgcgccgagcacggcatc
cgccacgtgatctacacgttcacgaagcaggacctgctcgagaacatcgacgacgcggtc
tattacggcgaattcttcgagaagatcgacgcgatcgattcggcgatcgcgcatttcggc
tactacatcgcgaacaagctcggcttgaaggttgcgctctgcggcgaaggcagcgacgag
atcttcggcggctacgatctgttcaagacgcacgcgcaacccggcgcgctgtcgctctat
cggctcaacaacctgcaccgcaccgatctgcagcgcgtcgatcgcgcgagcatgcgcaac
acggtcgaggcgcgggtgccgttcatggacgccgagctgatcgactacgtgctgagcctc
gacttctcgtacaaactgcacggcggcgtcgaaaagcatatcctgcgcgaggcgtttcgc
gacgtgctgccgggctacatcatcgatcgcccgaaaatcaggatgcccgacggcagcggc
gtgaagaacgtcatcatcgaccacatcgacagcctcggcgacgcgccgcccgacgatgcg
gcaaggcggctcggcgaaatcgggctgtccgaccgctcggcgctcttcttcgcgcggaag
tacctggagtgcaacttcccgtttccgacgcagcgcttcaagcaggccggcaaggatttt
tcggaatccggatatttcgacttcatctcatga

DBGET integrated database retrieval system