KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0901Help
Entry
GBP346_A0901      CDS       T00894                                 

Definition
fatty acid desaturase family protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    GBP346_A0901
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    GBP346_A0901
Enzymes [BR:bpr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     GBP346_A0901
Lipid biosynthesis proteins [BR:bpr01004]
 Desaturase
  First
   GBP346_A0901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:859545..860741
Genome map
AA seq 398 aa AA seqDB search
MLNSLLDFLSNGLLRFSWWQIVLFTLAVTHVTIVGVTVYLHRCQAHRALDLHPIMSHFFR
AWLWMTTGMLTGQWAAIHRKHHAKCETEEDPHSPQTRGIWKVLLEGAELYRAEAKNEETM
RKYGHGTPNDWLERNVYSKYPILGVSLMMVIDVALFGLVGLTVWAVQMVWIPFWAAGVVN
GLGHFWGYRNFNAADASTNLFPWGIVIGGEELHNNHHTFATSAKLSNKWYEFDIGWMYIR
IMSAFGLAKVKKIAPTPRLAARKTVLDQETLQAVLSNRYEVMARYAKTLKRAYRQELAHL
KELGAREKYQLMRGARKWFHKDEAGLDEPQKRMLPEIFANSQKLHTFFQLRAELTAIWER
SNASREQLLTQLQDWCHRAEQSGIKALQEFATRLRRYA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaattccctgctcgatttcctttccaacgggcttctgcgtttctcgtggtggcag
atcgtgctgttcacgctcgccgtcacgcacgtgacgatcgtcggcgtgacggtctatctg
catcgctgccaggcacaccgcgcgctcgatctgcatccgatcatgagccacttcttccgc
gcctggctgtggatgacgacgggcatgctgacgggccagtgggcggcgatccatcgcaag
caccatgcgaagtgcgagaccgaggaggatccgcacagcccgcagacgcgcggcatctgg
aaggtgctgctcgaaggcgccgagctgtatcgcgcggaggcgaagaacgaggagacgatg
cgcaagtacggccacggcacgccgaacgactggctcgagcgcaacgtctactcgaaatac
ccgattctcggcgtgagcctgatgatggtgatcgacgtcgcgctgttcggcctcgtcggc
ctcaccgtctgggcagtccagatggtgtggatcccgttctgggcggcgggcgtcgtcaac
ggtctcggccacttctggggctaccgcaacttcaacgcggccgacgcgagcacgaacctg
tttccgtggggcatcgtgatcggcggcgaggagctgcacaacaatcatcatacgtttgcg
acgtcggcgaagctgtcgaacaagtggtacgagttcgacatcggctggatgtacatccgc
atcatgtcggcgttcgggctcgcgaaggtaaagaagatcgcgccgacgccgcggctcgcc
gcgcgcaagacggtgctcgaccaggaaacgctgcaggccgtgctgtcgaaccgttacgag
gtgatggcgcgctatgcgaagacgctcaagcgcgcgtacaggcaggagctcgcgcacctg
aaggaactgggcgcgcgcgagaagtatcagctgatgcgcggcgcgcgcaaatggttccac
aaggacgaggcgggcctcgacgagccgcagaagcggatgctgccggagatcttcgcgaac
agccagaagctgcacacgttcttccaactgcgcgccgagctcacggcgatctgggagcgc
tcgaacgcctcgcgcgaacagctgctcacgcagttgcaggactggtgccatcgcgccgag
caaagcggcatcaaggcgttgcaggagttcgcgacgcgcctgcgccgctacgcgtga

DBGET integrated database retrieval system