KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0929Help
Entry
GBP346_A0929      CDS       T00894                                 

Definition
class II aldolase/adducin domain protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bpr00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(884425..885330)
Genome map
AA seq 301 aa AA seqDB search
MSFEKPIVSHDTLYPIIDFVFLMCRSDAPRTPYIRSRHGGGMVDTLKMGKAELVALAQRR
LDNEIKDSGWSAREKLALTCRILFDDGHDSGLAGQITCRADAPHTYYTQRLGLGFDEIAE
SNLLQVDQDLEVIGGQGIPNPANRFHTWIYRARPDVNCIIHTHPTHVAALSMLETPLVVS
HMDTCPLHGDCAFLKDWPGVPVGNEEGEIISNALGDKRAILLSHHGQLVVGKTIEEACML
AILIERAARLQLLAMAAGAIAPIPPALAADAHDWISTPKRDAVTFAYYARRALRRHPDCL
D
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgaaaaaccgattgtatctcatgacactttgtatcctataatcgacttcgtg
ttcttgatgtgtcgcagcgacgcaccaagaacaccgtacattcgttcacgtcatggaggc
ggtatggtcgacacattgaagatgggcaaggccgagctcgtcgcgctcgcgcagcggcgg
ctcgacaacgagatcaaggacagcgggtggagcgcgcgcgagaagctcgcgctcacctgc
cggatcctgttcgacgacgggcacgactccggcctcgccgggcagatcacgtgccgcgcc
gacgcgccgcacacgtactacacgcagcgcctcgggctcggcttcgacgagatcgccgaa
tcgaacctgctgcaggtcgatcaggacctcgaggtcatcggcggccagggcattccgaat
cccgcgaaccgctttcacacgtggatttatcgcgcgcgccccgacgtcaactgcatcatc
cacacgcacccgacgcacgtcgccgcgctgtcgatgctcgagacgccgctcgtcgtgtcg
cacatggacacctgtccgcttcacggcgactgcgcgttcctgaaggattggccgggcgtg
cccgtcggcaacgaggaaggcgagatcatctcgaacgcgctcggcgacaagcgcgcgatc
ctgctgtcgcatcacggccagctcgtcgtcggcaagacgatcgaagaggcgtgcatgctc
gcgattctgatcgagcgcgcggcgcggctgcaactgctcgcgatggcggccggcgcgatc
gcgccgattccgcccgcgctcgcggccgacgcgcacgactggatctcgacgcccaagcgc
gacgcggtgaccttcgcgtactacgcgcgccgcgcgctacgccgccaccccgactgcctc
gactga

DBGET integrated database retrieval system