KEGG   Burkholderia pseudomallei MSHR346: GBP346_A1411Help
Entry
GBP346_A1411      CDS       T00894                                 

Definition
exodeoxyribonuclease V, alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GBP346_A1411
Enzymes [BR:bpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     GBP346_A1411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1363027..1365723
Genome map
AA seq 898 aa AA seqDB search
MSVVDERFAWTGGLADRLPEPADFGLALAEGFARRIGMLSRRVGASAAAARWAARAAFAA
SRATAAGHVCVALRALAQRYDEPYDDVRAALAASGVTAFDGIVRGGECPLVVDRDGRLYL
ARYFEYETRLANALVERSRCGGAPAGGADALSPDALGERLVRYFGPQKERGVDWQRVAAL
IALTGRVTIVSGGPGTGKTTTVVGVIACLLDAHPELRIALAAPTGKAAQRMQEALHARAG
SLPAELAARLPRTSCTLHRLLGGGPGGRFAHHRDNPLPYDLVVVDEASMIDVALAAHLLD
ALAPNARLVLLGDKDQLAAVEAGAVFAELSARPAFSPATCATIARALGVGEAEFVEALPD
GFVVQAAGAERVADARAAAADMDAAARGAAGAAAAAARATAAAAARMTTAAAAARGAAPE
SAAQRAPAPHAGRRGGGRASNRTVDDAQGSLFAFDDDAFGVGTSGGEPGAGAQGAGRRDG
GAPSLDGPHAGRRDGGASPGVAHSRRDAFDARARSDSADVSDLENAARAYAPAGAAGPAD
SPADASFVEPAAWIEADELAWLDNAVFSFSEGASANAEADGRRSAAATATDAGARTAPPV
AREATAPTPRETARSDGSAVAPLTDCVVWLERNYRFGLDSPIGRLSLAIRRGAVQDALDA
LSTQDDAAARFSDDGGATLSAATVEQLARGFAGYAAALRDALATPEPDALPLFDVLNRFR
VLCATRTGARGAEEVNARMAAEVRRAVRVPLALGAHWFAGRPVMVTRNDYALGLFNGDIG
IALPGARGALRVWFRGADGRARAVSPAALPPHDTAFALTVHKSQGSEFDGAALILPASFN
RVLSRELVYTAITRARARVQVIGSRAVLALAIATRTARDSGLAARIADALRARQEGAR
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggtcgacgaacgtttcgcgtggacgggcggcctggcggaccgtctgcccgag
ccggccgatttcgggctcgcgctcgccgaaggcttcgcgcgccggatcgggatgctgtcg
cggcgtgtcggcgcgagcgccgcggccgcgcgctgggcggcacgcgcggcgttcgccgcg
agccgcgcgacggcggcggggcacgtatgcgtcgcgctgcgcgcgctcgcgcagcgctac
gacgagccgtacgacgacgtacgcgcggcgctcgccgcgagcggcgtgaccgcgttcgac
ggcatcgtgcgcggcggcgagtgcccactcgtcgtcgatcgcgatggtcggctgtatctc
gcgcgctacttcgaatacgagacgcggctcgcgaacgcgctcgtcgagcggagccgatgc
ggcggcgcgccggcgggcggcgccgatgcgctctcgcccgacgcgctcggcgagcggctc
gtccgctatttcgggccgcagaaggagcggggcgtcgattggcagcgcgttgcggcgctc
atcgcgctcacgggccgcgtgacgatcgtgagcggcgggccgggcaccggcaagacgacg
acggtcgtcggcgtgatcgcgtgcctgctcgatgcgcatccggagttgcggatcgcgctt
gccgcgcccaccggcaaggccgcgcagcggatgcaggaggcgctgcacgcgcgcgccggc
agcctgccggcggaactcgcggcgcgcctgccgcgcacgtcctgcacgctgcaccggctg
ctgggcggtggcccgggcgggcgcttcgcgcaccaccgcgacaatccgctgccgtacgat
ctcgtcgtcgtcgacgaggcttcgatgatcgacgtcgcgctcgctgcgcatttgctcgac
gcgctcgcgccgaacgcgcgcctcgtactgctcggcgacaaggatcagctcgcggccgtc
gaggcgggcgcggtgttcgccgagctgagcgcgcgtcccgcgttcagcccggcgacgtgc
gcgacgatcgcgcgcgcgctcggcgtcggcgaggccgagttcgtggaggcgctgccggac
gggttcgtcgtgcaggcggccggcgcggagcgcgtggcggacgcgcgtgcggcggcggcc
gatatggacgcggccgcgcgcggggcggccggcgccgcggctgcggccgcacgagcgacc
gcggccgcagccgcacgaatgaccacggccgcagccgcggcgaggggggccgcgccggaa
tccgccgcgcaacgcgcgccggcgccgcacgcgggccggcgcggcggcgggcgcgcatcg
aatcggaccgtcgacgatgcgcagggatcgctgttcgcgttcgacgacgacgcattcggt
gtgggcacgtcgggcggcgagccgggggccggcgcgcaaggtgccgggaggcgagatggc
ggggcgccgagcctcgacgggccgcacgccgggcgccgggacggcggcgcatcgcccggc
gtcgcgcacagccggcgcgatgcgttcgacgcgcgtgcccggtcggattcggcggatgtt
tccgacctggaaaacgccgcgcgcgcgtacgcgccggcgggcgcagccggcccggccgat
tcgccggcggacgcgtctttcgtcgagccggccgcgtggatcgaagcggacgaactcgcg
tggctcgacaacgcggtcttttcgttctccgaaggcgcttcggcgaatgccgaagccgac
gggcggcgaagcgccgcggcgacggcgaccgacgcgggcgcgcgcaccgcgccgccggtt
gcgcgggaagcgacggcgccgacgccgcgcgagaccgcgcgatcggacggttccgccgtc
gcgccgctgaccgactgcgtcgtctggcttgaacgcaactatcgcttcggccttgattcg
ccgatcggccggctgtcgcttgcgattcgccgcggcgcggtgcaggacgcgctcgacgcg
ctatcgacgcaagacgacgcggccgcgcgttttagcgacgacggcggcgcgacgctgtcg
gccgcgacggtcgagcagctcgcgcgaggcttcgccggctatgcggccgcgctgcgcgac
gcgctggcgacgcccgagcccgatgcgctgccgctcttcgacgtgctcaaccgctttcgc
gtgctttgcgcgacgcgcacgggcgcgcgcggcgcggaggaagtcaacgcgcgcatggcg
gccgaggtgcgccgcgcggtgcgcgtgccgctcgcgctcggcgcgcactggttcgccgga
cggcccgtgatggtgacgcgcaacgattacgcgctcggcctcttcaacggcgacatcggc
attgcgctgcccggcgcgcgcggtgcgctgcgcgtctggtttcgcggcgcggacggccgc
gcccgggcggtgtcgcccgccgcgctgccgccgcacgacacggcgttcgcgctgaccgtc
cacaaatcgcagggctcggaattcgacggcgcggcactgatcctgcccgcgtcgttcaat
cgcgtgctgtcgcgcgaactcgtctacaccgcgatcacgcgcgcgcgcgcgcgcgtgcag
gtgatcggctcgcgcgcggtgctcgcgctcgcgatcgcgacgcgcacggcgcgcgattcc
ggccttgccgcacgaatcgccgatgcgctgcgcgcgcggcaggagggcgcgcgatga

DBGET integrated database retrieval system