KEGG   Burkholderia pseudomallei MSHR346: GBP346_A1518Help
Entry
GBP346_A1518      CDS       T00894                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GBP346_A1518 (folP)
Enzymes [BR:bpr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     GBP346_A1518 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1454443..1455333
Genome map
AA seq 296 aa AA seqDB search
MSSSDSVFPVPAPLQCGRFTLTFERPLVMGILNVTPDSFSDGGRYVARDAALAQAERMLA
EGADILDIGGESTRPGAPPVPLNEELERVIPLVEALRGRNVPLSIDTYKPAVMRASLAAG
ADLINDIWGLRQPGAIDAVRDSACGLCVMHMLGEPRTMQVHAPEYRDVIDDVRAFLAERA
DALVQAGIDARRISVDPGFGFGKSVIEHNYALLAHLPRTAPVRPDGRAYPILAGMSRKSM
LGAVISRPAPERIAASVAAAVCAAERGAAIVRVHDVAATVDALKVWSAVRDAARRA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagttccgattccgtttttcccgttcccgcgccgctgcaatgcggccgtttcacc
ttgaccttcgagcgccccctcgtgatggggatcctcaacgtcacccccgattcgttctcc
gacggcggccgttacgtcgcccgtgacgccgcgctcgcgcaggcggagcggatgcttgcc
gaaggcgcggacatcctcgacatcggcggcgaatcgacgcgccccggcgcgccgcccgtg
ccgcttaacgaggagctcgagcgcgtgattccgctcgtcgaggcgctgcgcggccggaac
gtgccgctgtcgatcgacacgtacaagcccgccgtgatgcgcgcgtcgctcgccgcgggc
gccgatctgatcaacgatatctgggggctgcggcagccgggcgcgatcgacgcggtgcgc
gacagtgcgtgcggcctctgcgtgatgcacatgctcggcgagccgcggacgatgcaggtg
catgcgcccgagtatcgcgacgtgatcgacgacgtgcgcgcgtttctcgccgagcgcgcc
gatgcgctcgtgcaggcgggcatcgatgcccgacgtatcagcgtcgatccggggttcggt
ttcggcaagtcggtgatagaacacaactatgcgctgcttgcgcatttgccgaggaccgcg
cccgtgcggcccgacgggcgcgcgtatccgatcctcgccggcatgtcgcgcaagtcgatg
ctgggcgcggtgatcagcaggcccgcgccggagcgcatcgcggcgagtgtcgcggcggcg
gtctgcgcggccgagcggggggcggcgatcgtgcgcgtgcacgacgtcgccgcgaccgtc
gacgcattgaaagtatggagcgccgtgcgcgatgccgcgcggcgagcataa

DBGET integrated database retrieval system