KEGG   Burkholderia pseudomallei MSHR346: GBP346_A1579Help
Entry
GBP346_A1579      CDS       T00894                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GBP346_A1579 (malQ)
Enzymes [BR:bpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     GBP346_A1579 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1513997..1516201)
Genome map
AA seq 734 aa AA seqDB search
MTADPRHPSIVELADAAGLDAHWIDASGFARRVGDDMLAALLDALGYPCDTRAARAESAA
RLAAHAQAAPRLVTGDVDAPLTLPASLGRPGACYRVTLENGDAVAGRFAQPAGAAVLPPL
ATPGYHVLDTGEQRTTLAIAPPSAWTPADAMRAAAAGGRERPPPWGLAAQLYGLRREADG
GIGDFTALAACARAAARRGAHALAISPTQAAFPALPERDSPYSPSSRLWRNAAYIDVETV
LGAHAARAAIADAGLAAQWSALTRAPLVDWPGAVPAKLRVLRLLFDRWRARAPTGADAGP
RAFARFRARHAGALDAHATFDALQACCIDNGIGADWRRWPPAWRTPDAPDVAAFARAHAH
DIAFHAFLQWQAARGLAAAQRAARGRGMAIGLIADLPVGCDAAGSDAWRDGDAMLRGLSI
GAPADPFNARGQAWGVTTWTPTALRARGFAPFVECLRAGFAHAGGVRIDHVLGLARLWVV
RDGAYLRYPRDDLLRLAALESFRHRAIVIGEDLGTVPADFRARIAARGIVGLRALWFERD
PAGAFRAPGDWDRHAAATSSTHDLPTVAGWWRGVDLGWRWRAAASASACAPASSLSPASD
AEAEANAPPARPGESEVAGPDALPPEVRDMRRAERAALWRALQQAGVAARGQKMPPRDAP
PVGAILAYVAQAPAPLAIFPLEDLLALEGQPNVPGPPCGHPNWRRRMPRSVDALFDAPAR
TRIAAVRRARKRAR
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgatccgcgtcatccgtcgatcgtcgagctcgcggacgcggccgggctcgac
gcgcactggatcgacgcatcgggcttcgcgcggcgggtcggcgacgacatgctcgcggcg
ttgctcgacgcgctcggctacccgtgcgacacgcgcgcggcgcgcgccgagagcgccgcg
cggctcgcggcgcacgcgcaggccgcgccgcggctcgtgacgggcgacgtcgacgcgccg
ctcacgctgcccgcctcgctcggacgccccggcgcgtgctaccgggtcaccctcgaaaac
ggcgacgccgtcgccggccgcttcgcgcagcccgccggcgcagccgtgctgccgccgctc
gcgacgcccggctaccacgtgctcgacaccggcgagcagcgcacaacgctcgccatcgcg
ccgccatccgcatggacgcccgccgacgcgatgcgcgccgcagcggccggcggccgcgaa
cgcccgccgccgtggggcctcgcggcgcaactctacgggctgcgccgcgaggccgacggc
ggcatcggcgatttcaccgcgcttgccgcctgcgcgcgcgccgccgcccggcgcggcgcg
cacgcgctcgcgatcagcccgacgcaggcggccttccccgcgttgcccgagcgcgacagc
ccgtactcgccttcgtcgcggctttggcgcaacgccgcctacatcgacgtcgaaacggtg
ctcggcgcgcacgcggcgcgcgcggcgatcgccgatgcggggctcgccgcgcaatggagc
gcgctcacgcgcgcgccgctcgtcgattggcccggcgcggtgccggcgaagctgcgcgtg
ctgcgcctgctgttcgaccgctggcgcgcgcgggcgcccacgggcgcggatgcgggcccg
cgggcgttcgcgcgctttcgggcacggcacgccggcgcgctcgacgcacatgcgacgttc
gacgcgttgcaggcgtgctgcatcgacaacggcatcggcgcggactggcggcgttggccg
cccgcatggcgcacgcccgatgcgccggacgtcgccgcgttcgcgcgcgcgcacgcgcac
gacatcgcgttccacgccttcctgcaatggcaggccgcgcgcgggctcgcggccgcgcaa
cgcgccgcgcgcggccgcggcatggcgatcggcctgatcgcggacttgccggtcggctgc
gacgcggcgggcagcgacgcgtggcgggatggcgatgcgatgctgcgcggcctgtcgatc
ggcgcgcccgccgatccgttcaacgcgcgcggccaggcatggggcgtcaccacgtggacg
ccgacggcgctgcgcgcgcggggcttcgcgccgttcgtcgaatgtctgcgcgcgggcttc
gcgcacgcgggaggcgttcgcatcgatcacgtgctcggcctcgcgcggctgtgggtggtg
cgcgacggcgcgtacctgcgctatccgcgcgacgatttgctgcggctcgccgcgctcgaa
tcgttccggcatcgcgcgatcgtcatcggcgaggatctcggcaccgtgccggcggatttc
cgcgcgcggatcgccgcgcgcggcatcgtcggcctgcgcgcgctctggttcgaacgggac
ccggcgggcgcgttccgcgcgccgggcgattgggatcgtcacgcggccgcgacgagctcg
acgcacgatctgccgacggtcgcgggctggtggcgcggcgtcgatctcggctggcgatgg
cgcgcggccgcctccgcctcggcctgcgcgcccgcgtcctccctctctcccgcctccgac
gccgaggccgaggcgaacgccccgcccgcgcggcccggcgaatcggaggtcgccgggccg
gatgcgctgccgcccgaggtgcgcgacatgcgccgcgccgagcgcgcggcgctctggcgc
gcgctgcagcaagccggcgtcgccgcgcgcgggcaaaagatgccgccgcgggatgcgccc
cccgtcggtgcgatactcgcgtacgtcgcgcaagcgcccgcgccgctcgcgatctttccg
ctcgaggatctgctcgcgctcgagggccagccgaacgtgccgggcccgccgtgcgggcac
ccgaactggcggcggcgcatgccgcgctccgtcgacgcgctgttcgacgcgccggcgcgc
acgcgcatcgccgccgtgcggcgcgcgaggaagcgcgcgcgatga

DBGET integrated database retrieval system