KEGG   Burkholderia pseudomallei MSHR346: GBP346_A1674Help
Entry
GBP346_A1674      CDS       T00894                                 

Definition
di-heme cytochrome c peroxidase family protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bpr  Burkholderia pseudomallei MSHR346
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1610857..1612272
Genome map
AA seq 471 aa AA seqDB search
MMRRLPRYARQHRSFFVAPRAFAAAAALAAGVAACDANGPGASAAAAVAPAALAVPAASA
ASAASAARPAPLAQPAAPAVVDSQPQTRAQVYEAVKQMTALGRQLFFDPSLSGSGKLACA
SCHSPQHAFGPPNALPAQFGGDDLRQQGFRAVPTLKYLQKVPAFSEHYHESDDEGDESVD
AGPTGGLTWDGRVDSGAEQARAPLTSPFEMNGTPEKVARAVRAAPYAPAFRAAFGARVLD
DDRATFEAVLQALGTFEQAPDVFYPYTSKYDAYLAGRARLTRAELHGLQVFNDEKKGNCA
SCHVSRRGLDGSPPQFSDFGLIALGVPRNRALAVNRNPNFYDLGACGPERRDLKGRDEFC
GLFRTPTLRNVALKKTFFHNGVYHSLDDVLRFYAERDTHPEKFYPVKRGVVQKFDDLPKR
YWKNLNDEPPFERKRGDPPAMTDAEIRDVIAFLGTLTDGYDPRAKPAGGAR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccgcttgccgcgatacgcccgccagcaccgttcgttcttcgtcgcgccgcgc
gcgttcgcggccgccgccgcgcttgccgcgggcgtcgccgcgtgtgacgcgaacgggccg
ggcgcgagcgccgccgcggccgtcgcgcccgctgcgctcgctgtcccagccgcctccgct
gcctccgctgcctccgctgcgcgtcccgcgccgctcgcgcagccggccgcgcccgccgtc
gtcgacagtcagccgcagacgcgcgcgcaggtgtacgaggcggtcaagcagatgacggcg
ctcggcaggcagttgttcttcgatccttcgctgtcgggcagcggcaagctcgcctgcgcg
tcgtgccacagcccgcagcacgcgttcgggccgccgaacgcgctgcccgcgcaattcggc
ggcgacgatctgcgccagcagggctttcgcgccgtgccgacgctcaaatacctgcagaag
gtgcccgcgttcagcgagcactatcacgaatcggacgacgagggcgacgagagcgtcgac
gccggcccgacgggcgggctcacgtgggacggccgcgtggacagcggcgccgagcaggcg
cgcgcgccgctcacgtcgccgttcgagatgaacggcacgcccgagaaggtcgcgcgcgcg
gtgcgggccgcgccgtacgcgcccgcgtttcgcgcggcgttcggcgcgcgcgtgctcgac
gacgaccgcgcgacgttcgaggcggtgctgcaggcgctcggcacgttcgagcaggcgccc
gacgtgttctatccgtacacgagcaagtacgacgcgtacctggcgggccgcgcgcggttg
acgcgcgccgagctgcacgggctgcaggtcttcaacgacgagaagaagggcaactgcgcg
agctgccacgtgagccggcgcgggctcgacggctcgccgccgcagttcagcgatttcggc
ctgatcgcgctcggcgtgccgcgcaatcgcgcgctcgcggtgaatcggaatccgaatttt
tacgacctcggcgcatgcgggcccgagcgccgggacctgaaggggcgcgacgagttctgc
gggctgttccgcacgccgacgctgcgtaacgtcgcgctgaagaagacgttcttccacaac
ggcgtctatcactcgctcgacgacgtgctgcgcttctacgccgagcgcgacacgcatccg
gagaagttctatccggtgaagcgcggcgtcgttcagaagttcgacgacttgccgaagcgc
tactggaagaacctgaacgacgagccgccgttcgagcgcaagcgcggcgatccgcccgcg
atgaccgatgcggagatccgggacgtgatcgcgttcctcggcacgctcaccgacggctac
gatccgcgcgcgaagccggcaggcggcgcgcgctga

DBGET integrated database retrieval system