KEGG   Burkholderia pseudomallei MSHR346: GBP346_A1713Help
Entry
GBP346_A1713      CDS       T00894                                 

Gene name
galU_1
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr00040  Pentose and glucuronate interconversions
bpr00052  Galactose metabolism
bpr00500  Starch and sucrose metabolism
bpr00520  Amino sugar and nucleotide sugar metabolism
bpr01100  Metabolic pathways
bpr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GBP346_A1713 (galU_1)
   00052 Galactose metabolism
    GBP346_A1713 (galU_1)
   00500 Starch and sucrose metabolism
    GBP346_A1713 (galU_1)
   00520 Amino sugar and nucleotide sugar metabolism
    GBP346_A1713 (galU_1)
Enzymes [BR:bpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GBP346_A1713 (galU_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ACQ96138
UniProt: C4KWG0
Position
I:complement(1656100..1656981)
Genome map
AA seq 293 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLDLVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVADNPFAVILADDLLDGDPPVMKQMVDVFDHYHSSVIGVEEIPPEDTKSYGIVDGKEWE
DSIIKMSAIVEKPAPEVAPSNLGVVGRYVLKPRIFDHLRALKPGAGGELQLTDAIQALLA
DEQVLAYKYRGTRFDCGSKLGYLKATVEFALRHPEVKTEFETYLRSRSETQHG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaggcggttttcccggtcgcgggcctgggcacgcggttcctgccc
gccaccaaggcgagtccgaaggaaatgctgcccgtcgtcgacaaaccgttgatccagtat
gcggtggaagaagcgattgcagccggcatcaccgagatgatcttcgtgacgggccgcagc
aagcgcgcgatcgaggaccatttcgacaagtcgtacgagatcgaagcggagctcgaggcg
cgcggcaaggaaaagctgctcgatctcgtgcgcagcatcaagccgagccacgtcgactgc
ttctacgtgcgccagccggaagcgctcggcctgggccacgcggtgctgtgcgcggagaag
ctcgtcgcggacaatccgttcgcggtgatcctcgccgacgacctgctcgacggcgatcca
cccgtgatgaagcagatggtggacgtgttcgaccactatcacagctcggtgatcggcgtc
gaggagatcccgcccgaggacacgaagtcgtacgggatcgtcgacggcaaggaatgggaa
gactcgatcatcaagatgtcggcgatcgtcgagaaacccgcgcccgaagtcgcgccgtcg
aacctcggcgtcgtcggccgctacgtgctcaagccgcgcatcttcgatcacctgcgcgcg
ctcaagccgggcgcgggcggcgagctgcagttgaccgacgcgatccaggcgctcctcgcg
gacgaacaggtgctcgcatacaagtatcgcggcacccgcttcgactgcggcagcaagctc
ggctatctgaaggcgacggtcgagttcgcgctgcgccaccccgaagtgaagaccgagttc
gaaacgtatctgcgctcgcgcagcgaaacgcaacacgggtaa

DBGET integrated database retrieval system