KEGG   Burkholderia pseudomallei MSHR346: GBP346_A1713Help
Entry
GBP346_A1713      CDS       T00894                                 

Gene name
galU_1
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GBP346_A1713 (galU_1)
   00052 Galactose metabolism
    GBP346_A1713 (galU_1)
   00500 Starch and sucrose metabolism
    GBP346_A1713 (galU_1)
   00520 Amino sugar and nucleotide sugar metabolism
    GBP346_A1713 (galU_1)
Enzymes [BR:bpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GBP346_A1713 (galU_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1656100..1656981)
Genome map
AA seq 293 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLDLVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVADNPFAVILADDLLDGDPPVMKQMVDVFDHYHSSVIGVEEIPPEDTKSYGIVDGKEWE
DSIIKMSAIVEKPAPEVAPSNLGVVGRYVLKPRIFDHLRALKPGAGGELQLTDAIQALLA
DEQVLAYKYRGTRFDCGSKLGYLKATVEFALRHPEVKTEFETYLRSRSETQHG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaggcggttttcccggtcgcgggcctgggcacgcggttcctgccc
gccaccaaggcgagtccgaaggaaatgctgcccgtcgtcgacaaaccgttgatccagtat
gcggtggaagaagcgattgcagccggcatcaccgagatgatcttcgtgacgggccgcagc
aagcgcgcgatcgaggaccatttcgacaagtcgtacgagatcgaagcggagctcgaggcg
cgcggcaaggaaaagctgctcgatctcgtgcgcagcatcaagccgagccacgtcgactgc
ttctacgtgcgccagccggaagcgctcggcctgggccacgcggtgctgtgcgcggagaag
ctcgtcgcggacaatccgttcgcggtgatcctcgccgacgacctgctcgacggcgatcca
cccgtgatgaagcagatggtggacgtgttcgaccactatcacagctcggtgatcggcgtc
gaggagatcccgcccgaggacacgaagtcgtacgggatcgtcgacggcaaggaatgggaa
gactcgatcatcaagatgtcggcgatcgtcgagaaacccgcgcccgaagtcgcgccgtcg
aacctcggcgtcgtcggccgctacgtgctcaagccgcgcatcttcgatcacctgcgcgcg
ctcaagccgggcgcgggcggcgagctgcagttgaccgacgcgatccaggcgctcctcgcg
gacgaacaggtgctcgcatacaagtatcgcggcacccgcttcgactgcggcagcaagctc
ggctatctgaaggcgacggtcgagttcgcgctgcgccaccccgaagtgaagaccgagttc
gaaacgtatctgcgctcgcgcagcgaaacgcaacacgggtaa

DBGET integrated database retrieval system