KEGG   Burkholderia pseudomallei MSHR346: GBP346_A1794Help
Entry
GBP346_A1794      CDS       T00894                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bpr01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bpr00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bpr00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1746108..1747385
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQVIATIDTEAKAGAAAAAAGAADVQPAAAPVAAPAPAAQPAAAAASSTA
AASPAASKLMAEKGIGAGDVAGSGRDGRITKGDVLSAGSAPAAAPAAAPAKAAAKPALPE
VKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtttcggaagcgaccatg
ctgcagtggaagaagaagcccggcgaagccgtcgcgcaggacgaaatcctgatcgagctc
gagacggacaaggtcgtcctcgaagtgccggcgccggccgcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacacggtcgtcgccgaccaggtgatcgcgaccatcgacaccgaa
gcgaaggcaggcgccgccgcggcagcggcaggcgccgccgacgttcagccggccgccgct
cccgtcgccgcgccggcgcccgcagcacagccggccgccgccgccgcgtcgagcaccgcg
gccgcatcgcccgccgcgtcgaagctgatggccgagaagggcatcggcgccggcgacgtc
gccggctcgggccgcgacggccgcatcacgaagggcgacgtgctgtccgcgggcagcgcg
ccggccgccgcgccggccgccgcgccggcgaaggccgccgcgaagccggcgctgccggaa
gtgaaggtgccggcatcggcgacgacgtggctcaacgaccgtccggagcagcgcgtgccg
atgtcgcgcctgcgcgcgcgcatcgccgagcgtctgctcgaatcgcagcagaccaacgcg
atcctcacgacgttcaacgaagtgaacatgcagccggtgatggacctgcgcgcgaagtac
aaggacaagttcgagaaggagcacggcgtgaagctcggcttcatgtcgttcttcgtgaag
gcagccgttcacgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggcaacgac
atcgtctaccacggctacttcgacatcggcatcgcggtcggttcgccgcgcggcctcgtc
gtgccgatcctgcgcaacgcggatcagctgagcctcgccgagatcgagaagaagatcgcc
gaattcggccagaaggcaaaggacggcaagctgtcgatcgaggaaatgacgggcggcacg
ttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccg
ccgcagtcggcgatcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaacggc
cagatcgtgatccgcccgatcaactatctcgcgctgtcgtacgaccaccggatcatcgac
ggtcgcgaagcggtgctgtcgctcgtcgcgatgaaggacgcgctcgaagatccggcgcgc
ctgctgctcgacctgtaa

DBGET integrated database retrieval system