KEGG   Burkholderia pseudomallei MSHR346: GBP346_A1895Help
Entry
GBP346_A1895      CDS       T00894                                 

Gene name
rbsK_1
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GBP346_A1895 (rbsK_1)
Enzymes [BR:bpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GBP346_A1895 (rbsK_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1833976..1834950
Genome map
AA seq 324 aa AA seqDB search
MTAAVERAAGGASPARAGRVMVVGSLNMDLVVRSARLPRPGETLAGRSFAQAAGGKGGNQ
AVAAARLGAQVAMLGRVGADAHGAALRAGLVAEGIDCVALSVSATATTGVALIVVDDASQ
NAIVIVAGSNGEVTPESIAGHEAAIAAADVLICQLETPAAAVRAALAAGRRLGKTVVLNP
APAAGPLPADWLPLVDYLIPNEIEAAALTGLPVRDPVSAETAARALAAAGARNVIVTLGG
QGVLALTADGDARHYPAPRVAPVDTTAAGDTFIGGFAARLAARDAPHDAIRFAQRAAALS
VTRAGAQPSIPTLAELDAFAPGPA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgccgtcgaacgcgcggccggcggggcctcgcccgcgcgcgccggcagggtg
atggtggtcggcagcctgaacatggacctcgtcgtgcgctcggcgcggctgccgcggccg
ggcgagacgctcgccggccgctcgttcgcgcaggcggcgggcggcaagggcggcaaccag
gcggtcgcggccgcgcggctcggcgcgcaggtggcgatgctcggccgcgtcggcgcggac
gcgcacggcgccgcgctgcgcgcggggctcgtcgccgaggggatcgattgcgtcgcgctg
tcggtcagcgcgacggcgacgacgggcgtcgcgctcatcgtcgtcgacgatgcgagccag
aacgcgatcgtgatcgtcgcgggcagcaacggcgaggtgacccccgaatcgatcgccggg
cacgaggcggcgatcgccgcggccgacgtgctgatctgccagctcgagacgcccgccgcc
gcggttcgcgcggcgctggccgccggccgccggctcggcaagaccgtcgtgctgaatccg
gcgcccgctgccggcccgctgcccgccgactggttgccgctcgtcgattacctgatcccg
aacgaaatcgaggccgccgcgctgaccggcttgccggtgcgcgacccggtgagcgccgag
accgccgcgcgcgcgcttgcggcggctggcgcgcgcaacgtgatcgtcacgctgggcggc
cagggcgttctcgcgctgacggcggacggcgacgcgcgccactacccggcgccgcgcgtc
gcgcccgtcgacacgacggccgcgggggacacgttcatcggaggtttcgccgcgcggctc
gccgcgcgcgacgcgccgcacgacgcgatccggttcgcgcagcgcgcggctgcgttgtcg
gtcacgcgcgcgggcgcgcagccgtcgattccgacgctcgccgagctcgacgcgttcgcg
ccggggccggcgtga

DBGET integrated database retrieval system