KEGG   Burkholderia pseudomallei MSHR346: GBP346_A1980Help
Entry
GBP346_A1980      CDS       T00894                                 

Definition
magnesium chelatase subunit ChlI (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bpr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1935613..1936896
Genome map
AA seq 427 aa AA seqDB search
MNPTNEAGAATAAASDDRALPAAYPFSALIGQAALQQALLLVAVDPGLGGVLVSGPRGTA
KSTAARALAELLPEGRFVTLPLSASDEQVTGSLDLASALADNTVRFSPGLVARAHLGVLY
VDEINLLPDALVDALLDAAASGVNTVERDGVSHSHAARFALVGTMNPEEGELRPQLLDRF
GLMVELANCYDAATRQRIVKARLAFDLDPHGFRAQYRDAQAALVAQIRAARAALPALAFD
DAAHARVAELCIGAAVDGLRGDLVMLRAARALAALDGAARVAAAHVERVAADVLRHRRTR
FEPQPEFQPGFQPGSQAGPQPMGRREPPPASRSAGGDAPGGRADPGEAEATRAPTPRDAL
PGGASGPAHPAARAPSDAQRRAADERAAARDGGRGPAADDSDWGYLPPEPAGIAPVKGVI
PLPLKKR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttgaacccaacgaacgaagccggcgcggcaacggccgccgcctccgacgaccgcgcattg
ccggccgcctatccgttttccgcgctgatcggccaggcggcgttgcagcaggcgctgctg
ctcgtcgccgtcgatccgggcctgggcggcgtgctcgtgagcggcccgcgcggcaccgcg
aaatcgaccgccgcgcgcgcgctcgccgagctgctgcccgaggggcgcttcgtcacgctg
ccgctatcggccagcgacgagcaggtgacgggttcgctcgacctcgcgagcgcgctcgcc
gacaatacggtgcgcttttcgcccggcctcgtcgcgcgcgcgcatctcggcgtgctgtac
gtcgacgagatcaacctgctgccggacgcgctcgtcgacgcgttgctcgacgcggccgcg
agcggcgtcaacacggtcgagcgcgacggcgtgtcgcacagccacgcggcgcgcttcgcg
ctcgtcggcacgatgaacccggaagagggcgagttgcgcccgcaactgctcgaccgtttc
gggctgatggtggagctcgcgaactgctacgacgcggcgacgcggcagcggatcgtcaag
gcgcggctcgcgttcgatctcgatccgcacggctttcgcgcgcagtaccgcgacgcgcag
gcggcgctcgtcgcgcaaattcgcgcggcgcgcgccgcgctgccggcgctcgcgttcgac
gacgccgcgcacgcgcgcgtcgccgagctgtgcatcggcgcggccgtcgacggcctgcgc
ggcgacctcgtgatgctgcgcgccgcgcgggcgctcgcggcgctcgacggggcggcgcgc
gtcgccgcggcgcacgtcgagcgcgtcgccgccgatgtgctgcgccatcggcgcacgcgg
ttcgagccgcaacctgaatttcagcccggatttcaacccgggtctcaagccgggcctcag
ccgatggggcgacgcgagcctccgcccgcatcgcgttcggccggcggcgacgcgccgggc
gggcgcgcggatccgggcgaagccgaagccacgcgcgcgcccacgcctcgcgacgcgctg
cccggcggcgcgagcggaccggcgcatcccgctgcgcgcgcgccgtccgacgcgcagcgg
cgcgcggcggacgagcgcgccgcggcgcgcgacggcggccgtgggccggccgccgacgat
agcgactggggctatctgccgcccgagccggcgggcatcgcgcccgtcaagggcgtgatc
ccgctgccgctaaaaaaacgctga

DBGET integrated database retrieval system