KEGG   Burkholderia pseudomallei MSHR346: GBP346_A2185Help
Entry
GBP346_A2185      CDS       T00894                                 

Gene name
nosZ
Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    GBP346_A2185 (nosZ)
Enzymes [BR:bpr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     GBP346_A2185 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2155282..2157249
Genome map
AA seq 655 aa AA seqDB search
MANSKENTEAAAAPQDARRRRFLASSAVAGLAGAGLSLGLAGCNKGGDAPAAASGAGASA
ASGAAAAPAIDFGKYEVHPGKLDTYYTFSSGGHSGDIRVHGLPSGREIRRIPVYNIDCMS
GWGITNESRKIIGTKANGQLEYFTGDTHHVHMSYTDGTYDGKYIFVNDKINARIARVRLD
TMECDAITPLPNVQGFHGIFPDKRDPLDQTINYTTRVFCGNEFHIPHPNDGRDLNDPKKY
YCLFTCVDAKTMQPRWQVKIDGNMDLVATSYDGKLACSNQYNTENGVHYEEMMAAERDAC
VFFNVARIEEAVKNGKFFKVGNSPVPVVDGTRAANADPKTALTCYVSVPKNPHGVNASPD
GKYYACSGKLSPTATLISHELMLKWFAGELKEPRDAVVAEPEIGLGPLHTGFDGKGYAYT
TLFLDSQIVKWSLEEAIKAYKGEKAAKVVVDRIDVHYQPGHGFTSMGETKEPDGQFFISD
NKFSKDRYLPVGPLHPDSAQLIDISGEKMLLVADHPTYPEPHDSIVVRRDIIKTRQIYNL
DEFPLAVKNAKDSRVERHGRKVTVYLTSQAPTFGLREWTVKKGDEVTIILTNLDKVEDLT
HGFAIPFYNINFVVHPQQTQSVTFIADKPGVFWCFCTNFCHALHLEMRSRMLVEA
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggctaattcgaaggaaaacaccgaagcggcggcagcgccgcaggacgcgcggcggcgc
aggttcctcgcctcgtcggcggtcgcggggctcgcgggcgcgggcctgtcgctcggcctc
gcgggctgcaacaagggcggcgacgcgcccgccgcggcgagcggcgcgggcgcgagcgcg
gcgagcggcgcggctgcggcccccgcaatcgacttcggcaagtacgaagtgcatccgggc
aagctcgatacgtactacacgttctcgagcggcggccattcgggcgacatccgcgtgcac
ggcctgccgtccgggcgcgagatccggcgcattcccgtctacaacatcgactgcatgtcc
ggctggggcatcacgaacgaatcgcgcaagatcatcggcaccaaggccaacggccagctc
gaatacttcacgggcgacacgcaccacgtgcacatgtcctatacggacggcacgtacgac
ggcaagtacatcttcgtgaacgacaagatcaatgcgcgcatcgcgcgcgtgcgcctcgac
acgatggagtgcgacgcgatcacgccgctaccgaacgtgcagggctttcacggcatcttc
cccgacaagcgcgatccgctcgaccagacgatcaactacacgacgcgcgtgttctgcggc
aacgagttccacattccgcacccgaacgacggccgcgacctgaacgacccgaagaagtac
tactgcctgttcacctgcgtcgacgcgaagacgatgcagccgcgctggcaggtgaagatc
gacggcaacatggatctcgtcgcgacgtcgtatgacggcaagctcgcgtgctcgaaccag
tacaacaccgagaacggcgtgcattacgaggaaatgatggcggccgagcgcgacgcgtgc
gtgttcttcaacgtcgcgcgcatcgaggaagcggtgaagaacggcaagttcttcaaggtg
ggcaactcgcccgtgcccgtcgtcgacggcacgcgcgcggcgaacgccgatccgaagacg
gccctcacctgctacgtgagcgtgccgaagaacccgcacggcgtgaacgcgtcgcccgac
ggcaagtactacgcgtgctcgggcaagctctcgcccaccgcgacgctgatctcgcacgag
ctgatgctcaagtggttcgcgggcgagctcaaggagccgcgcgacgcggtggtcgcggag
ccggagatcggcctcgggccgctgcataccggcttcgacggcaagggctacgcgtacacg
acgctctttctcgacagccagatcgtcaagtggagcctcgaggaagcgatcaaggcgtac
aagggcgagaaggcggcgaaagtcgtcgtcgaccggatcgacgtgcactaccagccgggc
cacggcttcacgtcgatgggcgagacgaaggagccggacggccagttcttcatctcggac
aacaagttctcgaaggaccgctacctgcccgtcgggccgctgcatccggacagcgcgcag
ttgatcgacatcagcggcgagaagatgctgctcgtggccgaccatccgacgtatcccgag
ccgcacgactcgatcgtcgtgcgccgcgacatcatcaagacacggcagatctacaacctc
gacgagttcccgctcgcggtgaagaacgcgaaggacagccgcgtcgagcggcacggcagg
aaggtcaccgtctacctgacgtcgcaggcgccgaccttcgggctgcgcgaatggaccgtg
aagaaaggcgacgaggtcacgatcatcctgaccaacctcgacaaggtggaggacctgacg
cacggcttcgcgatcccgttctacaacatcaacttcgtcgtgcatccgcagcagacgcag
tcggtgacgttcatcgcggacaagcccggcgtgttctggtgcttctgcacgaacttctgc
cacgcgctgcatctggagatgcgctcgcggatgctcgtcgaggcgtag

DBGET integrated database retrieval system