KEGG   Burkholderia pseudomallei MSHR346: GBP346_A2339Help
Entry
GBP346_A2339      CDS       T00894                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GBP346_A2339 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GBP346_A2339 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GBP346_A2339 (thrC)
Enzymes [BR:bpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GBP346_A2339 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2302664..2304115)
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGIGERHTFSDILLGGLAKDGGLYLPSEYPRVSADELARWRALPYADLAFEI
LAKFCDDIPADDLRAITRRTYTADVYRHTRHGGNAADITPLTTLGAENGAPVSLLELSNG
PTLAFKDMAMQLLGNLFEYTLAAHGETLNILGATSGDTGSAAEYAMRGKRGVRVFMLSPH
RKMSAFQTAQMYSLQDPNIFNLAVKGVFDDCQDIVKAVSNDHAFKAQQKIGTVNSINWAR
VVAQVVYYFKGYFAATRTNDERVSFTVPSGNFGNVCAGHIARMMGLPIEKLVVATNENDV
LDEFFRTGAYRVRSAEHTYHTSSPSMDISKASNFERFVFDLLGRDPARVVQLFRDVEQKG
GFDLAASGDFARVAEFGFVSGRSTHADRLATIRDVFERYRTTIDTHTADGLKVAREHLQP
GVPMIVLETAQPIKFGETIREALGQEPSRPAAFDGLEALPQRFEVVDASAQQVKDFIAAH
TGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaattacatctccacgcgcggcgccggcatcggcgagcgtcacacgttctccgacatc
ctgctcggcggcctcgcgaaggacggcgggctctacctgccgagcgagtatccgcgggtg
agcgcggacgagctcgcgcgctggcgcgcgctgccgtacgcggatctcgcgttcgagatc
ctcgcgaagttctgcgacgacatcccggccgacgacctgcgcgcgatcacgcgccgcacg
tatacggccgacgtctatcgtcacacgcgccacggcggcaacgcggccgacatcacgccg
ctcacgacgctcggtgccgagaacggcgcgccggtctcgctgctcgaactgtcgaacggc
ccgacgctcgcgttcaaggacatggcgatgcagttgctcggcaacctgttcgagtacacg
ctcgccgcgcacggcgaaacgctgaacatcctcggcgcgacgtcgggcgatacgggcagc
gcggccgaatacgcgatgcgcggcaagcggggcgtgcgcgtgttcatgctgtcgccgcac
cggaagatgagtgcgttccagacggctcagatgtacagcctgcaggacccgaacatcttc
aacctcgcggtgaagggcgtgttcgacgattgccaggacatcgtgaaggccgtgtcgaac
gatcacgcgttcaaggcgcagcagaagatcggcacggtcaattcgatcaactgggcgcgt
gtcgtcgcgcaggtcgtgtactacttcaagggctacttcgcggcgacgcgcacgaacgac
gagcgcgtgtcttttacggtgccgtcgggcaacttcggcaatgtctgcgcgggccacatc
gcgcggatgatggggctgccgatcgagaagctcgtcgtcgcgaccaacgagaacgacgtg
ctcgacgaattcttccgcacgggtgcgtatcgcgtgcgcagcgccgagcacacgtaccac
acgagcagcccgagcatggacatctcgaaggcgtcgaacttcgagcgcttcgtgttcgac
ctgctcggccgcgatccggcgcgcgtcgttcagctgtttcgcgacgtcgagcaaaagggt
ggcttcgatctcgcggcgagcggcgatttcgcgcgcgtcgccgagttcggcttcgtgtcg
ggccgcagcacgcacgcggaccggctcgcgacgatccgcgacgtgttcgagcgctaccgc
acgacgatcgacacgcatacggccgacggcctgaaagtggcgcgcgagcatctgcagccg
ggcgtgccgatgatcgtgctcgagaccgcgcagccgatcaagttcggcgaaacgattcgc
gaggcgctcgggcaggagccgtcgcggcccgccgcgttcgacgggctcgaggcgctgccg
cagcgcttcgaggtggtcgacgcgagcgcgcagcaggtgaaggacttcatcgccgcgcac
acgggcgcatga

DBGET integrated database retrieval system