KEGG   Burkholderia pseudomallei MSHR346: GBP346_A2419Help
Entry
GBP346_A2419      CDS       T00894                                 

Definition
putative acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    GBP346_A2419
Enzymes [BR:bpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     GBP346_A2419
   3.1.2  Thioester hydrolases
    3.1.2.-  
     GBP346_A2419
Lipid biosynthesis proteins [BR:bpr01004]
 Fatty acid synthase
  Component type
   GBP346_A2419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2374666..2375346
Genome map
AA seq 226 aa AA seqDB search
MSMKRTVHWKAGATLAVVATFAGPASAATNAAPAPNADGGKPVIVVLGDSLSAEYGLPRD
TGWVALMRARLAAERIDYSVANASISGDTTSGGRARLPAVLARLKPAVVVVELGANDALR
GVPLAATEGNLREIVAQARQARAQVLLVGMYVPSNYGPDYTQKFRGVYTGLSKEMRVPLV
PFLLAGIENKPDMFQADQIHPTQAAQRQLLDNVWPALKPLLRTSSH
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttgagcatgaaacgcacagttcactggaaggccggcgcgacgctcgccgtggtcgcgacg
ttcgccggcccggcatccgccgccacgaatgcagcgcccgcgccgaacgccgacggcggc
aagccggtgatcgtcgtgctcggcgacagcctgtcggccgaatacggcctgccgcgcgat
acgggctgggtcgcgctgatgcgcgcgcgcctcgcggccgagcgaatcgattatagcgtc
gcgaacgcgagcatctccggcgacacgacgagcggcggccgcgcgcggctgcccgcggtg
ctcgcacggctcaagccggccgtcgtcgtcgtcgaactcggcgcgaacgacgcgctgcgc
ggcgtgccgctcgccgcgaccgaaggcaacctgcgcgagatcgtcgcgcaggcgcggcag
gcgcgcgcgcaggtgctgctcgtcggcatgtacgtgccgtcgaactacggcccggactac
acgcaaaagttccgcggcgtctacacggggctgtccaaggagatgcgcgtgccgctcgtg
ccgttcctgctcgccggcatcgagaacaagcccgacatgttccaggccgaccagatccat
ccgacgcaggccgcgcagcgccagttgctcgacaacgtatggccggccctcaagccgctg
ctgcggacgtcatcgcactga

DBGET integrated database retrieval system