KEGG   Burkholderia pseudomallei MSHR346: GBP346_A2576Help
Entry
GBP346_A2576      CDS       T00894                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GBP346_A2576 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    GBP346_A2576 (dapE)
Enzymes [BR:bpr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     GBP346_A2576 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2512595..2513734
Genome map
AA seq 379 aa AA seqDB search
MSATLALTEQLIARASVTPDDQHCQQLMIERLAALGFECETIASHGVTNFWAVKRGTAGR
AGKLLAFAGHTDVVPTGPLEQWSSPPFVPTHRDGKLYGRGAADMKTSLAGFVVAAEEFVA
AHPQHRGSIGFLITSDEEGPATDGTVKVVEALAARGERLDYCIVGEPTSTATLGDVVKNG
RRGSMSGELVVKGVQGHIAYPHLAKNPIHLLAPALAELAAEQWDEGNEYFPPTTWQVSNL
RAGTGATNVIPGHADLLFNFRFSTASTVEGLQARVHAILDRHGLDYTLNWSVSGLPFLTP
RGELSNALDAAIRAETGVSPELSTTGGTSDGRFIARICPQVIEFGPPNASIHKIDEHIDV
RFVDPLKNVYRRVLEQLIA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccacccttgccctcaccgaacagttgatcgcgcgcgcgtccgtcacgcccgac
gatcagcactgccagcaattgatgatcgagcgcctcgccgccctcggcttcgagtgcgaa
acgatcgcgtcgcacggcgtgacgaacttctgggccgtcaagcgcggcacggccggccgc
gcaggcaagctgctcgcgttcgcgggccataccgacgtcgtgccgaccggcccgctcgag
cagtggagctcgccgccgttcgtgccgacgcaccgcgacggcaagctgtacggccgcggc
gcggccgacatgaaaacctcgctcgcgggcttcgtcgtcgcggccgaggagttcgtcgcc
gcgcatccgcagcaccgcggctcgatcggtttcctgatcacgagcgacgaggaaggcccg
gccaccgacggcaccgtgaaagtcgtcgaggcgctcgccgcgcgcggcgagcgcctcgat
tactgcatcgtcggcgaaccgacctcgacggcgacgctcggcgacgtcgtgaagaacggc
cggcgcggctcgatgtcgggcgagctcgtcgtcaagggcgtgcaaggccatatcgcgtat
ccgcatctcgcgaagaacccgatccatctgctcgcgccggcgctcgccgagctcgccgcc
gagcaatgggacgaaggcaacgagtactttccgccgaccacctggcaggtgtcgaacctg
cgcgcgggcaccggcgcgacgaacgtgattccgggccacgccgatctgctgttcaacttc
cgcttctcgacggcgagcacggtcgagggcctgcaggcgcgcgtgcacgcgatcctcgac
aggcacgggctcgattacacgctgaactggtcggtgagcggcctgccgttcctcacgccg
cgcggcgagctgtcgaacgcgctcgacgccgcgatccgcgcggaaacgggcgtctcgccc
gagctgtcgacgacgggcggcacgtccgacggccgcttcatcgcgcgcatctgcccgcag
gtgatcgagttcggcccgccgaacgcgagcatccacaagatcgacgagcacatcgacgtg
cgcttcgtcgacccgctgaagaacgtgtaccgccgcgtgctcgaacaactgatcgcctga

DBGET integrated database retrieval system