KEGG   Burkholderia pseudomallei MSHR346: GBP346_A2579Help
Entry
GBP346_A2579      CDS       T00894                                 

Definition
(GenBank) peroxiredoxin Hyr1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr00480  Glutathione metabolism
bpr00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GBP346_A2579
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GBP346_A2579
Enzymes [BR:bpr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GBP346_A2579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ACQ96308
UniProt: C4KPA4
Position
I:complement(2516511..2516990)
Genome map
AA seq 159 aa AA seqDB search
MSKLYSFNAQALSGGEVPLEQYRGKVLLIVNTASECGFTPQYAGLQQLYDRFRERGLVVL
GFPCNQFGKQEPGDASQIGAFCEKNYGVTFPMFGKIDVNGANAHPLYRYLTEEAPGILGL
KAIKWNFTKFLVNREGEIVKRYAPSTKPEDIAADVEKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaactgtattcattcaacgcgcaggcgctttcggggggcgaggtgccgctcgag
caataccggggcaaggtgctcctcatcgtcaacacggcgagcgagtgcggattcacgccg
cagtacgcggggctgcagcaactgtacgatcgctttcgcgaacgcgggcttgtcgtgctc
ggctttccgtgcaatcagttcggcaagcaggagccgggcgatgcgtcgcagatcggcgcg
ttctgcgagaagaattacggcgtcacgttcccgatgttcgggaagatcgatgtgaacggc
gcgaacgcgcacccgctataccggtatctgaccgaggaggcgcccggcattctcggcctg
aaggcgatcaagtggaatttcacgaagttcctcgtgaaccgggagggcgagatcgtgaag
cgctatgcgccgtcgacgaagcccgaggatatcgccgcggacgtcgaaaagctgctttga

DBGET integrated database retrieval system