KEGG   Burkholderia pseudomallei MSHR346: GBP346_A2594Help
Entry
GBP346_A2594      CDS       T00894                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GBP346_A2594 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GBP346_A2594 (aceA)
Enzymes [BR:bpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     GBP346_A2594 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:2531092..2532660
Genome map
AA seq 522 aa AA seqDB search
MLRGTTQPIAAWKTTFRNKKYRRQSIDFNGINFLQLREKAPCLDAVDLPRLLYKTSRTKP
PNPNRAVRFAQSKISSLQATTTQGVRIMSRQQQAQELQKQWETDPRWKGIKRAFTAEDVV
RLRGSIQQEHTLAKRGAEKLWTLINNEPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVA
GDANVAGEMYPDQSLYPANSVPLVVKRINNTLTRADQIQWSEGKNPGDEGYVDFFAPIVA
DAEAGFGGVLNAFELMKAMIEAGASGVHFEDQLASVKKCGHMGGKVLVPTREAVAKLTAA
RLAADVMGTPTVLVARTDAEAADLITSDIDDNDKPYLTGERTVEGFFRTKPGLEQAISRG
LAYAPYADLIWCETGKPDLEYAKKFAEAIHKQFPGKLLSYNCSPSFNWKKNLDDATIAKF
QKELGAMGYKFQFITLAGFHALNYSMFNLAHGYARTQMSAFVELQQAEFAAADKGFTAVK
HQREVGTGYFDAVTQTVEREASTTALHGSTEDEQFFDGQKVA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtggcacaacccagcccattgcagcatggaaaaccacattccgcaataagaaa
tatagacgtcaatctattgattttaatggaataaattttttacagcttcgtgaaaaagcc
ccctgtctcgacgccgtcgatttgcctagactcttatacaagacttcacgaacgaaaccg
ccgaaccccaatcgcgccgtccgtttcgcccagtcaaagatttcttctcttcaggcaacg
accactcaaggagtacgcatcatgtcgcgtcaacaacaggctcaggaactgcaaaagcaa
tgggaaaccgatccgcgctggaagggcatcaagcgcgcgttcaccgctgaggacgtcgtg
cgcctgcgcggctcgatccagcaagagcacacgctcgcgaagcgcggcgcggaaaagctc
tggacgctcatcaacaacgagccgttcgtcaacgcactcggcgcgctgacgggcaaccag
gcgatgcagcaggtcaaggccggcctcaaggcgatctatctgtcgggctggcaagtcgcg
ggcgacgcgaacgtcgcgggcgaaatgtatccggaccagtcgctgtacccggcgaactcg
gtgccgctcgtcgtcaagcgcatcaacaacacgctcacgcgcgccgatcagatccagtgg
tcggaaggcaagaaccccggcgacgaaggctatgtcgacttcttcgcgccgatcgtcgcc
gacgcggaagccggcttcggcggcgtgctgaacgcgttcgaactgatgaaggcgatgatc
gaggcgggcgcgtcgggcgttcacttcgaagatcagctcgcatcggtcaagaagtgcggc
cacatgggcggcaaggtgctcgtgccgacccgcgaggcggtcgcgaagctgacggccgcg
cgtctcgccgccgacgtgatgggcacgccgaccgtgctggtcgcgcgcaccgacgccgaa
gcggcagacctgatcacgtccgacatcgacgacaacgacaagccgtacctgacgggcgag
cgcacggtcgaaggcttcttccgcacgaagccgggcctcgagcaggcgatctcgcgcggc
ctcgcctatgcgccgtacgccgacctgatctggtgcgaaaccggcaagccggatctcgaa
tacgcgaagaagttcgcggaagcgatccacaagcagttcccgggcaagctgctgtcgtac
aactgctcgccgtcgttcaactggaagaagaacctcgacgacgcgacgatcgcgaagttc
cagaaggaactcggcgcgatgggctacaagttccagttcatcacgctcgccggcttccat
gcgctgaactactcgatgttcaacctcgcgcacggctacgcccgcacgcagatgagcgcg
ttcgtcgaactgcagcaagccgagttcgcggcggccgacaagggcttcaccgcggtcaag
caccagcgtgaagtcggcaccggctacttcgacgcggtgactcagacggtcgagcgcgaa
gcgtcgacgaccgcgctgcacggctcgaccgaagacgaacagttcttcgacggccagaaa
gtcgcctga

DBGET integrated database retrieval system