KEGG   Burkholderia pseudomallei MSHR346: GBP346_A2594Help
Entry
GBP346_A2594      CDS       T00894                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr00630  Glyoxylate and dicarboxylate metabolism
bpr01100  Metabolic pathways
bpr01110  Biosynthesis of secondary metabolites
bpr01120  Microbial metabolism in diverse environments
bpr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GBP346_A2594 (aceA)
Enzymes [BR:bpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     GBP346_A2594 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACQ97440
UniProt: C4KPB9
Structure
PDB: 

Jmol
Position
I:2531092..2532660
Genome map
AA seq 522 aa AA seqDB search
MLRGTTQPIAAWKTTFRNKKYRRQSIDFNGINFLQLREKAPCLDAVDLPRLLYKTSRTKP
PNPNRAVRFAQSKISSLQATTTQGVRIMSRQQQAQELQKQWETDPRWKGIKRAFTAEDVV
RLRGSIQQEHTLAKRGAEKLWTLINNEPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVA
GDANVAGEMYPDQSLYPANSVPLVVKRINNTLTRADQIQWSEGKNPGDEGYVDFFAPIVA
DAEAGFGGVLNAFELMKAMIEAGASGVHFEDQLASVKKCGHMGGKVLVPTREAVAKLTAA
RLAADVMGTPTVLVARTDAEAADLITSDIDDNDKPYLTGERTVEGFFRTKPGLEQAISRG
LAYAPYADLIWCETGKPDLEYAKKFAEAIHKQFPGKLLSYNCSPSFNWKKNLDDATIAKF
QKELGAMGYKFQFITLAGFHALNYSMFNLAHGYARTQMSAFVELQQAEFAAADKGFTAVK
HQREVGTGYFDAVTQTVEREASTTALHGSTEDEQFFDGQKVA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtggcacaacccagcccattgcagcatggaaaaccacattccgcaataagaaa
tatagacgtcaatctattgattttaatggaataaattttttacagcttcgtgaaaaagcc
ccctgtctcgacgccgtcgatttgcctagactcttatacaagacttcacgaacgaaaccg
ccgaaccccaatcgcgccgtccgtttcgcccagtcaaagatttcttctcttcaggcaacg
accactcaaggagtacgcatcatgtcgcgtcaacaacaggctcaggaactgcaaaagcaa
tgggaaaccgatccgcgctggaagggcatcaagcgcgcgttcaccgctgaggacgtcgtg
cgcctgcgcggctcgatccagcaagagcacacgctcgcgaagcgcggcgcggaaaagctc
tggacgctcatcaacaacgagccgttcgtcaacgcactcggcgcgctgacgggcaaccag
gcgatgcagcaggtcaaggccggcctcaaggcgatctatctgtcgggctggcaagtcgcg
ggcgacgcgaacgtcgcgggcgaaatgtatccggaccagtcgctgtacccggcgaactcg
gtgccgctcgtcgtcaagcgcatcaacaacacgctcacgcgcgccgatcagatccagtgg
tcggaaggcaagaaccccggcgacgaaggctatgtcgacttcttcgcgccgatcgtcgcc
gacgcggaagccggcttcggcggcgtgctgaacgcgttcgaactgatgaaggcgatgatc
gaggcgggcgcgtcgggcgttcacttcgaagatcagctcgcatcggtcaagaagtgcggc
cacatgggcggcaaggtgctcgtgccgacccgcgaggcggtcgcgaagctgacggccgcg
cgtctcgccgccgacgtgatgggcacgccgaccgtgctggtcgcgcgcaccgacgccgaa
gcggcagacctgatcacgtccgacatcgacgacaacgacaagccgtacctgacgggcgag
cgcacggtcgaaggcttcttccgcacgaagccgggcctcgagcaggcgatctcgcgcggc
ctcgcctatgcgccgtacgccgacctgatctggtgcgaaaccggcaagccggatctcgaa
tacgcgaagaagttcgcggaagcgatccacaagcagttcccgggcaagctgctgtcgtac
aactgctcgccgtcgttcaactggaagaagaacctcgacgacgcgacgatcgcgaagttc
cagaaggaactcggcgcgatgggctacaagttccagttcatcacgctcgccggcttccat
gcgctgaactactcgatgttcaacctcgcgcacggctacgcccgcacgcagatgagcgcg
ttcgtcgaactgcagcaagccgagttcgcggcggccgacaagggcttcaccgcggtcaag
caccagcgtgaagtcggcaccggctacttcgacgcggtgactcagacggtcgagcgcgaa
gcgtcgacgaccgcgctgcacggctcgaccgaagacgaacagttcttcgacggccagaaa
gtcgcctga

DBGET integrated database retrieval system