KEGG   Burkholderia pseudomallei MSHR346: GBP346_A2791Help
Entry
GBP346_A2791      CDS       T00894                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase E2 component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr00010  Glycolysis / Gluconeogenesis
bpr00020  Citrate cycle (TCA cycle)
bpr00620  Pyruvate metabolism
bpr01100  Metabolic pathways
bpr01110  Biosynthesis of secondary metabolites
bpr01120  Microbial metabolism in diverse environments
bpr01130  Biosynthesis of antibiotics
bpr01200  Carbon metabolism
Module
bpr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBP346_A2791 (aceF)
   00020 Citrate cycle (TCA cycle)
    GBP346_A2791 (aceF)
   00620 Pyruvate metabolism
    GBP346_A2791 (aceF)
Enzymes [BR:bpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GBP346_A2791 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 NQRA DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ACQ98845
UniProt: C4KQN2
Position
I:complement(2718286..2719929)
Genome map
AA seq 547 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKPGDAVEPEQSLVTLESDKATMDVPSPSAGTVKEV
KVKVGDAVSQGSLIVLLDGAQAAAQPAQANGAATSAAQPAAAPAAAPAPAAAAGGGTVDV
KVPDIGDYKDVPVIEIAVKIGDTVEKEQSLVTLESDKATMDVPSPAAGVVKDIKVKVGDA
VSEGSLIVVLEASGGAAASAPQAAAPAPAPAAPAPAPAPQAAPAAAPAPAQAPAPAASGE
YRASHASPSVRKFARELGVDVSRVTGTGPKSRITKDDVTAFVKGVMTGQRAAPGAAAAPA
GGGELNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITELEA
LRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYHIGFAADTP
NGLVVPVIRDADKKGLVDIAKEMAELSKAAREGKLKPDQMQGGCFSISSLGGIGGTHFTP
IINAPEVAILGLSRGQMKPVWDGKQFVPRLMLPLSLSYDHRVIDGAEAARFNAYLGALLA
DFRRIIL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggatatcggcgattacaaggacgtgcccgtc
atcgaagtgctcgtgaagccgggcgatgcggtcgagcccgagcagtcgctcgtcacgctc
gaatcggacaaggcgacgatggatgtgccgagcccgtcggcgggcacggtcaaggaagtg
aaggtgaaggtcggcgacgcggtgtcgcaaggctcgctgatcgtgctgctcgacggcgcg
caggcggcggcccagcccgcgcaggcgaacggcgccgcgacgagcgccgcgcagccggcg
gcggcgcccgctgccgcgcctgcgccggcggcggccgcgggcggcggcacggtcgacgtg
aaggtgccggacatcggcgactacaaggacgtgcccgtcatcgagatcgccgtgaagatc
ggcgacacggtcgagaaggagcagtcgctcgtcacgctcgaatcggacaaggcgacgatg
gacgtgccgagcccggccgcgggcgtcgtcaaggacatcaaggtgaaggtcggcgatgcg
gtgtcggaaggctcgctgatcgtcgtgctcgaagcgtcgggcggcgccgccgcgagcgcg
ccgcaggcggccgcgcccgcccccgcgccggccgcgccggctccggcgcccgcgccgcag
gccgcacccgcggctgcgccggcccccgcgcaggcaccggcacccgccgcgagcggcgag
taccgcgcgagccacgcgtcgccgtcggtgcgcaagttcgcgcgcgagctcggcgtcgac
gtgtcgcgcgtcacgggcacggggccgaagagccgtatcacgaaggacgacgtcaccgcg
ttcgtgaagggggtgatgacggggcagcgcgcggcgcccggcgccgcggccgcgcccgcg
ggcggcggcgagctgaacctgctgccgtggccgaaggtcgacttctcgaagttcggcccg
ttcgaggcgaagccgctgtcgcgcatcaagaagatctcgggcgcgaacctgcatcgcaac
tgggtgatgatcccgcacgtcacgaacaacgacgaggcggacatcaccgagcttgaagcg
ctgcgcgtgcaactgaacaaggagcacgagaaggcgggcgtgaagttcacgatgctcgcg
ttcgtgatcaaggcggtcgtcgccgcgctgaagaagttcccgaccttcaacgcgagcctc
gacggcgacaacctcgtgttcaagcagtactaccacatcggtttcgccgccgacacgccg
aacggcctcgtcgtgccggtgatccgcgacgcggacaagaaggggctcgtcgacatcgcg
aaggaaatggccgagctgtcgaaggccgcgcgcgaaggcaagctcaagccggaccagatg
cagggcggctgcttctcgatctcgtcgcttggcgggatcggcggcacgcacttcacgccg
atcatcaatgcgccggaagtggcgatcctcgggctgtcgcgcggccagatgaagccggtg
tgggacggcaagcagtttgtgccgcgcctcatgctgccgctgtcgctgtcgtatgaccat
cgcgtgatcgatggcgcggaagccgcgcggttcaatgcgtatctcggcgcgttgcttgcc
gatttccgtcgcatcattctttga

DBGET integrated database retrieval system