KEGG   Burkholderia pseudomallei MSHR346: GBP346_A3243Help
Entry
GBP346_A3243      CDS       T00894                                 

Definition
protein-L-isoaspartate
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bpr  Burkholderia pseudomallei MSHR346
Brite
Enzymes [BR:bpr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     GBP346_A3243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3130694..3131347
Genome map
AA seq 217 aa AA seqDB search
MNIEKARFNMIEQQIRPWDVLDQDVLSLLSVVKRENFVPAAYRDLAFADVELPLPSGQKM
LFPRVEARILQELAVKKHENVLEIGAGCGYMAALLAARGQRVTTVEIDPDLAKFAEENLK
KNGVTNAEVVLGDGSRGWPAKAPYDVICVSGGLPVVPQELLEQLKVGGRLAAFVGGRPVM
KAQIITRIDDTQYRVADVFETYVDHLVNAIEPSRFKF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgaaaaagcacgtttcaacatgatcgaacagcagatccggccttgggatgta
ctggatcaggacgtcttgagcctgctgtcggtcgtcaagcgtgagaatttcgtgccggcc
gcgtatcgcgacctggcgttcgccgacgtcgagctgccgctgccgagcggccagaagatg
ctgttcccgcgcgtcgaggcccgcatcctgcaggagctcgcggtgaagaagcacgagaac
gtgctcgagatcggggcgggctgcggctacatggcggccttgctggccgcgcgcggccag
cgcgtgacgacggtcgagatcgatccggatctcgcgaagttcgccgaagagaacctgaag
aagaacggcgtgacgaacgccgaggtcgtgctcggcgacggctcgcgcggctggcccgcg
aaagcgccgtacgacgtgatctgcgtgtcgggcggcctgcccgtcgtcccgcaggaactg
ctcgagcaactgaaggtgggcggccgcctcgcggcgttcgtcggcggccggccggtgatg
aaggcgcagatcatcacgcgcatcgacgacacgcaatatcgcgtcgccgacgtattcgag
acctacgtcgatcacctcgtcaacgcgatcgagccgtcgcgcttcaagttctga

DBGET integrated database retrieval system