KEGG   Burkholderia pseudomallei MSHR346: GBP346_A3263Help
Entry
GBP346_A3263      CDS       T00894                                 

Definition
phosphomannomutase/phosphoglucomutase (PMM/PGM) (EC:5.4.2.8 5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBP346_A3263
   00030 Pentose phosphate pathway
    GBP346_A3263
   00051 Fructose and mannose metabolism
    GBP346_A3263
   00052 Galactose metabolism
    GBP346_A3263
   00500 Starch and sucrose metabolism
    GBP346_A3263
   00520 Amino sugar and nucleotide sugar metabolism
    GBP346_A3263
  Nucleotide metabolism
   00230 Purine metabolism
    GBP346_A3263
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GBP346_A3263
Enzymes [BR:bpr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     GBP346_A3263
    5.4.2.8  phosphomannomutase
     GBP346_A3263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3148810..3150375)
Genome map
AA seq 521 aa AA seqDB search
MGAIGVAETSDYKLDRIRFRHRRCVALPPSPVGSGEDFLRIRVEAAKFFMDDTESESMIS
QSIFKAYDIRGVIGKTLDADVARSIGRAFGSEVRAQGGDAVVVARDGRLSGPDLVGALAD
GLRAAGVDVVDVGMVPTPVGYFAASVPLALSGGERRVDSCIVVTGSHNPPDYNGFKMVLR
GAAIYGDQIQGLYKRIVDARFETGNGSYERYDVADQYVERIVGDIRLARPLKLVVDAGNG
VAGPLATRLFKALGCELVELFTDIDGNFPNHHPDPAHPENLQDVIAKLKTTDAEIGFAFD
GDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRNLAQWVREKGGEPL
MWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILARAADPSAL
LNGLPNAVSTPELQLKLDEGENVKLIDKLRADAKFDGADEVVTIDGLRVEYPDGFGLARS
SNTTPVVVLRFEASSDAALARIQDDFRRALKAAKPDANLPF
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgatcggcgtagctgaaaccagcgattataagttggatcggattcgcttccgg
catcggcggtgcgttgcgttgcccccctcgccggtcggttcgggcgaggattttttacgc
attcgcgttgaggcggccaaattttttatggacgacacagagagtgaatcgatgatctcc
caatccatcttcaaggcatacgatattcggggcgtgatcggcaagacgctcgacgccgac
gtcgcgcgctcgatcggccgcgcattcggcagcgaagtgcgcgcgcagggcggcgacgcg
gtcgtcgtcgcgcgcgacggccggctctcggggcccgatctcgtcggcgcgctcgcggac
gggctgcgcgcggcgggcgtcgatgtcgtcgacgtcggcatggtgccgacgcccgtcggc
tacttcgcggcgagcgtgccgctcgcgctgtcgggcggcgagcgccgcgtcgattcgtgc
atcgtcgtcacgggcagccacaatccgcccgactacaacggtttcaagatggtcctgcgc
ggcgccgcgatttacggcgaccagatccagggcctgtacaagcgcatcgtcgacgcgcgt
ttcgagaccggcaacggttcgtatgagcgatacgatgtcgccgatcaatacgtcgagcgc
atcgtcggcgacatcaggctcgcgcggccgctgaagctcgtcgtcgatgcgggcaacggc
gtcgcgggcccgctcgcgacgcgcctgttcaaggcgctcggctgcgaactcgtcgagctc
ttcaccgacatcgacggcaacttcccgaaccaccacccggacccggcgcacccggagaac
ctgcaggacgtgatcgcgaagctgaagacgaccgatgccgagatcggcttcgcgttcgac
ggcgacggcgaccgcctcggcgtcgtcacgaaggacggccagatcatctatccggaccgc
cagctgatgctgttcgccgaggaagtgctgtcgcgcaacccgggcgcgcagatcatctac
gacgtgaagtgcacgcgcaatctcgcgcagtgggtgcgcgagaagggcggcgagccgctg
atgtggaagacgggccactcgctcgtgaaggcgaagctgcgcgagacgggcgcgccgctc
gcgggcgagatgagcggccacgtgttcttcaaggatcgctggtacggcttcgacgacggc
ctctacacgggcgcgcgcctgctcgagatcctcgcgcgcgcggccgatccgagcgcgctg
ctcaacggcttgccgaacgcggtgtcgacgcccgagctgcaactgaagctcgacgaaggc
gagaacgtgaagctgatcgacaagctgcgcgccgacgcgaagttcgacggcgcggacgag
gtcgtgacgatcgacggtctgcgcgtcgagtatccggacggcttcggtctcgcgcgttcg
tcgaacacgacgcccgtggtcgtgctgcgcttcgaggcgagctccgacgcggcgctcgcg
cggatccaggacgatttccggcgcgcgctgaaggcggcgaagccggacgcgaacctgccg
ttctga

DBGET integrated database retrieval system