KEGG   Burkholderia pseudomallei MSHR346: GBP346_A3619Help
Entry
GBP346_A3619      CDS       T00894                                 

Definition
ribonuclease SA
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bpr  Burkholderia pseudomallei MSHR346
Brite
Enzymes [BR:bpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     GBP346_A3619
Transfer RNA biogenesis [BR:bpr03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    GBP346_A3619
 Prokaryotic Type
    GBP346_A3619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3493242..3493673)
Genome map
AA seq 143 aa AA seqDB search
MARKWLRNGALASVFAIVAMGNIGATPGSLVSAAYAREAATVDGAAAQVDTIPASRLPRE
AATTLSLIAAGGPYPYGKDGAVFGNYERILPKMRRGYYHEYTVPTPRARNRGARRIVCGG
PLRRVDNCYYTGDHYNSFKRIVD
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggctccgcaacggcgcgctcgcgtccgtcttcgcgatcgtcgcgatg
ggcaacatcggcgctacgccgggcagtctggtttccgccgcatacgcacgggaagccgcc
acggtcgacggggcggcggcgcaggtcgatacgatccccgcatcccgtttgccgcgcgag
gcagcaaccacgctcagcctgatcgccgcgggcggtccctatccgtacgggaaagacggc
gcggtattcggcaattacgaacggatcttgccgaagatgcggcgcggctattaccacgag
tacacggtgccgacgccgcgcgcccgcaatcgcggcgcgcggcgcatcgtctgcggcggc
cccttgaggcgcgtcgacaattgttattacaccggcgaccactacaacagtttcaaacgt
atcgttgattga

DBGET integrated database retrieval system