KEGG   Burkholderia pseudomallei MSHR346: GBP346_A3733Help
Entry
GBP346_A3733      CDS       T00894                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GBP346_A3733 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GBP346_A3733 (trpC)
Enzymes [BR:bpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GBP346_A3733 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3605274..3606059
Genome map
AA seq 261 aa AA seqDB search
MSDILDKIIAVKREEIAAALESAPLEELKVQASARDSRDFVGALRDKHAAGHAAVIAEVK
KASPSKGVLREHFVPAAIARSYAQHGAACLSVLTDERFFQGSARYLEQARAACALPVLRK
DFIVDAYQVLEARAMGADAILLIAAALDTPLMIDLEAYAHSLGLAVLVEVHNRGELDEAL
KLKTPLVGINNRNLRTFETTIDTTLGMLDAIPDDRIVVTESGILSRADVERMEAAGVHTF
LVGEAFMRAENPGAELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctcgacaaaatcatcgccgtcaagcgcgaagagatcgccgccgcgctc
gagagcgcgccgctcgaagaactgaaggtgcaggcgtcggcgcgcgattcgcgcgacttc
gtcggcgcgctgcgcgacaagcacgcggccggacacgccgccgtcatcgccgaggtgaag
aaggcgagcccgtcgaaaggcgtgctgcgcgagcatttcgtgccggccgccatcgcccgc
tcgtacgcgcagcacggcgccgcatgcctgtcggtgctgaccgacgagcggttcttccag
ggcagcgcgcgctatctcgaacaggcgcgcgccgcgtgcgccctgcccgtgctgcgcaag
gacttcatcgtcgacgcgtaccaggtgctcgaagcgcgcgcgatgggcgcggacgcgatc
ctgctgatcgccgcggcgctcgacacgccgctgatgatcgatctcgaggcgtacgcgcat
tcgctcgggctcgcggtgctcgtcgaagtgcacaaccgcggcgaactggacgaagcgttg
aaactgaagacgccgctcgtcggcatcaacaaccgcaacctgcgtacattcgagacgacg
atcgacacgacgctcggcatgctcgacgcgattccggacgatcggatcgtcgtcaccgaa
tccggcatcctgtcgcgcgcggacgtcgagcggatggaggcggcgggcgtgcatacgttc
ctcgtcggcgaagcgttcatgcgcgccgagaacccgggcgcggaactcgcgcggatgttc
ttctga

DBGET integrated database retrieval system