KEGG   Burkholderia pseudomallei MSHR346: GBP346_A4036Help
Entry
GBP346_A4036      CDS       T00894                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bpr02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bpr02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3868285..3869379)
Genome map
AA seq 364 aa AA seqDB search
MQKKIKVLCVDDSALIRSLMTEIINSQPDMEVCATAPDPLVARELIKQHNPDVLTLDVEM
PRMDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGAVDFVTKPRVGIRDGMLDY
SEKLADKVRAASRARVRQNPQPHAAAAAAAHGHAGAAAPLINNPLVSTEKLIIVGASTGG
TEAIREVLTPLPPDAPAVLIAQHMPPGFTRSFAQRLNGLCRISVKEAEHGERVLPGHAYI
APGHAHLLLARSGANYIAHLSDEPPVNRHRPSVDVLFRSAAQHAGKNALGVILTGMGRDG
AAGLLEMKKAGAYTFAQDEASCVVFGMPREAIAMGGVDDVAPLSDMSRRIMARLASMGDR
VQRV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaagaaaatcaaagtgctgtgcgtcgacgattcggcgctgatccgcagcctgatg
acagaaatcatcaacagccagcccgacatggaagtgtgcgcaacggcgcccgatccgctc
gtggcgcgcgagctgatcaagcagcacaacccggacgtgctgacgctcgacgtcgaaatg
ccgcggatggacgggctcgacttccttgaaaagctgatgcgcctgcggccgatgccggtc
gtgatggtgtcgtcgctcaccgagcgcggctcggagatcacgctgcgcgcgctcgagctg
ggcgcggtcgatttcgtgacgaagccgcgcgtcgggattcgcgacggcatgctcgactat
tcggaaaagctggccgacaaggtgcgcgcggcatcgcgcgcgcgcgtgcggcagaatccg
cagccgcatgcggccgccgccgcggccgcgcacggccacgcgggcgccgccgcgccgctc
atcaacaatccgcttgtcagtaccgagaagctgatcatcgtcggcgcgtccacgggcggc
accgaggcgatccgcgaagtgctgacgccgctgccgcccgatgcgcccgccgtgctgatc
gcgcagcacatgccgcccggcttcacgcgctcgttcgcgcagcgcctgaacgggctgtgc
cggatctcggtgaaggaggcggagcacggcgagcgcgtgctgccggggcacgcgtatatc
gcgcccggccacgcgcacctgctgctcgcgaggagcggcgcgaactacatcgcgcacctg
tcggacgagccgcccgtcaatcgtcatcgcccgtcggtcgacgtgctgttccgctcggcc
gcgcagcatgcgggcaagaacgcgctcggcgtgatcctgacgggcatgggccgcgacggc
gcggccgggctgcttgaaatgaaaaaggccggcgcgtatacatttgcgcaggacgaggcg
agctgcgtcgtgttcggaatgccgcgcgaggcgatcgcgatgggcggcgtcgacgacgtc
gcgcccctttccgacatgagtcgccgtatcatggcgcgcctcgcgtcgatgggcgatcgc
gtgcagcgcgtgtga

DBGET integrated database retrieval system