KEGG   Burkholderia pseudomallei MSHR346: GBP346_A4237Help
Entry
GBP346_A4237      CDS       T00894                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bpr  Burkholderia pseudomallei MSHR346
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:4056055..4059084
Genome map
AA seq 1009 aa AA seqDB search
MQLHFESDLDYQLEAIEAVCDLFRGQEACRAEFSVTAQAARRRAGPQISLGMAESGLGVG
NRLTLDAHTFAENLARVQVRNGLPPSGAPSSNDFTVEMETGTGKTYVYLRTIFELHRRFD
FTKFVIVVPSVAIKEGVHKTLQITEQHFRRLYAGVPFDYFVYDSAKLGEVRSFASKSIVQ
IMIVTVAAINKKDVNTLYKDSEHTGGEKPIDLIRATHPIVIVDEPQSVDGGLEGRGKEAL
DAMRPLCTLRYSATHADKYQMLYRLDAIDAYERKLVKQIEIASATVEDAHNKPFVRVISI
GSRRGAIAARVELDVATAAGDVERQTVSVSDGDDLERVARRAVYANFSIGEIHAARGAEY
LVLRYPGGDAFLSVGDAYGDVDTHAIQREMIRRTIREHLDKELRLTPLGVKVLSLFFVDA
VDKYRKYDRHGQPFKGDYALLFEDEYRRAAKLPEYRALFDGVDAGLAAEAAHDGYFSIDK
KGGWTDTSDRSAGSRENAERAYGLIMKDKERLLSFDTPLKFIFSHSALKEGWDNPNVFQI
CTLRDIHSERERRQTIGRGLRLAVNQRGERVRGFDVNTLTVIAGESYEQFAENLQKEIEA
DTGIRFGIVETHQFAALPVPADDGSVQPLGVERSAALWMHLRDAGYLDARGRVQDTLRAA
LKLRALPLPDEFDALRALIVDMLRKLAGRLDVRNADERRHIALRRDAHGKAVYLGDAFRA
LWDRIRHRTTYRVNFDNARLIERCVAALKAAPAVTRARLQWRKADIAIDASGVEATETED
AGAIAIDEGEVELPDLLTELQDRTQLTRRTIAKVLIESGRLDEFPLNPQRFIALVAAALE
RCKRDALVDGIEYRLLGEAQVHALSLFESEPLTGYLSSMRRDAAKSIHEDVPCDTPAERA
FVESLEQDDAVRLYAKLPGWFKIPTPLGSYSPDWAVLITEGDGPRLYFVVESKSGVADGD
LRADERRRVQCGAAHFRALEAVADNPARYVRARRADDLPTAAADARDAA
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgcatttcgagtcggatctcgactatcagctcgaagcgatcgaggcggtatgc
gatctgtttcgcggccaggaggcgtgccgcgccgaattcagcgtcaccgcgcaggccgcg
cggcggcgcgcgggcccgcagatttcgctcgggatggccgaatcggggctcggcgtcggc
aatcgcctgacgcttgatgcgcacacgttcgccgagaatctcgcgcgcgtgcaggtgcgc
aacggcctgccgccgtccggcgcgcccagctcgaacgatttcaccgtcgagatggaaacg
ggcacgggcaagacctacgtgtacctgcgcacgatcttcgagctgcaccgccgcttcgac
ttcacgaagttcgtgatcgtcgtgccgtcggtcgcgatcaaggagggggtgcacaagacg
ctgcagatcaccgagcagcatttccggcgcctttacgcgggcgtgccgttcgactatttc
gtctacgattcggcgaagctcggcgaggtgcgcagcttcgcgtcgaaatcgatcgtgcag
atcatgatcgtcacggtcgcggcgatcaacaagaaggacgtcaacacgctctacaaggac
agcgaacatacgggcggcgagaagccgatcgacctgattcgcgcgacgcacccgatcgtg
atcgtcgacgagccgcagagcgtggacggcgggctcgaggggcgcggcaaggaggcgctc
gacgcgatgcgcccgctctgcacgctgcgctactcggcgacgcacgcggacaagtatcag
atgctgtaccggctcgacgcgatcgacgcttacgagcgcaagctcgtcaagcagatcgag
atcgcgtcggcgaccgtcgaggacgcgcacaacaagccgttcgtgcgcgtgatatcgatc
ggcagccggcgcggcgcgatcgccgcgcgcgtcgagctcgacgtcgcgacggccgcgggc
gatgtcgagcggcagacggtttccgtctccgacggcgacgatctggagcgcgtggcgcgt
cgcgccgtctatgcgaatttttcgatcggcgagattcacgcggcgcgcggcgccgaatat
ctggtgctgcgctatccgggcggcgacgcgttcctgtcggtcggcgacgcatacggcgac
gtcgatacgcacgcgatccagcgcgagatgatccgccgcacgatccgcgagcatctcgac
aaggagctgcgcctcaccccgctcggcgtgaaggtgctgtcgctcttcttcgtcgacgcg
gtcgacaagtatcgcaagtacgaccgccacggccagccgttcaagggcgactacgcgctg
ctgttcgaagacgaataccggcgcgcggcgaagctgcccgaatatcgcgcgctgttcgac
ggcgtcgacgcgggcctcgcggccgaggcggcgcacgacggctatttctcgatcgacaag
aaaggcggctggaccgacacgagcgaccggagcgccggcagccgggagaatgcggagcgc
gcgtacgggctcatcatgaaggacaaggagcggctgctgtcgttcgacacgccgctgaag
ttcatcttctcgcactcggcgctgaaggaaggctgggacaatccgaacgtgttccagatc
tgcacgctgcgcgacatccacagcgagcgcgagcgccgccagacgatcggccgcgggctg
cgtctcgccgtcaaccagcgcggcgagcgcgtgcgcggtttcgacgtcaatacgctgacg
gtgatcgcgggcgaaagctacgagcagttcgccgagaatctgcaaaaggagatcgaagcc
gatacggggatccgcttcggcatcgtcgagacgcaccagttcgccgcgctgccggtgccg
gccgacgacggcagcgtgcagccgctcggcgtcgaacgctccgccgcgctgtggatgcat
ctgcgcgacgccggctatctcgacgcgcgcggccgcgtgcaggacacgctgcgcgcggcg
ctcaagctgcgcgcgttgccgctgcccgacgagttcgacgcgctgcgcgcgctgatcgtc
gacatgctgcgcaagctggcgggccggctcgacgtgcgcaacgcggacgagcgccgccac
atcgcgctgcggcgcgacgcgcacggcaaggcggtgtacctgggcgacgcattccgcgcg
ctgtgggaccgcatccggcaccgcacgacgtaccgcgtgaacttcgacaacgcgcgcctg
atcgagcgctgcgtcgccgcgctgaaggcggcgcccgccgtcacgcgcgcgcggctgcag
tggcgcaaggccgatatcgcgatcgacgcgtcgggcgtcgaggcgaccgaaaccgaggat
gcgggcgcgatcgcgatcgacgaaggcgaggtcgagctgccggatctgctgaccgagctg
caggaccgcacgcagctcacgcgccgcacgatcgcgaaagtgctgatcgaaagcggccgg
ctcgacgagttcccgctcaatccgcagcgcttcatcgcgctcgtcgccgcggcgctcgag
cgttgcaagcgcgacgcgctcgtcgacgggatcgagtacaggctgctcggcgaagcgcag
gtgcacgcgctttcgctgttcgagagcgagccgctcaccggctatctgtcgagcatgcgg
cgcgacgcggcgaaatcgattcacgaggacgtgccgtgcgacacgcccgccgagcgcgcg
ttcgtcgaatcgctcgaacaggacgacgcggtcaggctgtacgcgaagctgcccggctgg
ttcaagattccgacgccgcttggcagctacagccccgactgggcggtgctgatcaccgaa
ggcgacgggccgcggctctatttcgtcgtcgaatcgaagagcggcgtcgccgacggcgat
ctgcgcgctgacgagcggcgcagggtccagtgcggcgctgcgcatttccgcgcgctggag
gcggtggcggacaaccccgcgcgctacgtgcgcgcgcgccgcgccgacgatctgccgacg
gccgctgccgacgcgcgcgatgcggcctga

DBGET integrated database retrieval system