KEGG   Beta proteobacterium CB: D521_0106Help
Entry
D521_0106         CDS       T02483                                 

Definition
Histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bprc  Beta proteobacterium CB
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bprc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    D521_0106
  Amino acid metabolism
   00340 Histidine metabolism
    D521_0106
Enzymes [BR:bprc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     D521_0106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
97293..98615
Genome map
AA seq 440 aa AA seqDB search
MSAEVMVKRLNSKDAGFKEALLSSLSLPMADDEAIDAAVVNILAQVKGEGDAAVLSFTKQ
FDRLNISSVTELEISPEELKTAYEGLSAEQKNALDIAAQRVRAYHERQKIEAGCHSWEYE
EDDGTRLGQKVTALDRVGIYVPGGKAAYPSSVLMNAIPAKVAGVKEVIMVVPTPDGARNT
LVLAAAYLSGVDRVFTIGGAQAVGALAYGTQTIPPVDKIVGPGNAYVAAAKRRVFGTVGI
DMIAGPSEILVLCDGSSNPDWIAMDLFSQAEHDELAQSILLCPDEKFIEQVQVSINKLLP
DMPRKKVIETSLTNRALLIQVKDMGEACEIANAIAAEHLEICATEPRKWAELIRHAGAIF
MGNYTSESLGDYCAGPNHVLPTARTARFSSPLGVYDFIKRSSMIEVSEAGAQTLGAVAST
LAHGEGLTAHARAAEMRLKK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagaagtcatggtcaagcgccttaatagcaaagatgctgggttcaaagaagcc
ctgctctccagcctttctttgcctatggcggatgatgaggcgattgatgctgcagtagta
aatattctggcgcaagtgaagggtgagggtgatgctgctgtgctctcctttacaaagcag
tttgatcgtctcaatatttcaagtgttactgagttagaaatttctccagaagaattaaaa
acagcttacgaaggtttatctgctgaacaaaaaaatgctcttgatatcgctgcgcaaaga
gtgcgtgcttatcacgagaggcagaagattgaagcgggttgccactcttgggaatacgaa
gaggatgatggcacccgattaggtcaaaaagtaacagccttagatcgtgtgggtatttat
gttcctggcggcaaggctgcttatccatcttctgtgttgatgaatgcaattcctgccaag
gttgctggtgtgaaagaagtcatcatggtggtacccacccctgatggcgctcgcaatacc
ttggtcttggctgctgcttacttatctggtgttgatcgcgtctttacgattggtggtgca
caagcagttggcgccttagcttatggcacgcaaactattccaccggtagacaaaattgtt
ggccctggcaatgcctatgttgcagccgccaagcgtagagtctttggtactgttggcatt
gatatgatcgccggcccttcagaaattttggtcctctgtgacggctctagcaatcccgat
tggatcgcgatggatttattttctcaagctgagcatgatgagttagcgcaatctattttg
ctttgtccagatgagaaatttattgagcaagtgcaagtaagcattaataagttattacct
gacatgccaagaaagaaagtgattgaaacatcgcttactaatcgtgctttattgattcag
gtaaaagatatgggcgaggcttgtgagattgccaatgccattgctgccgagcatttagaa
atttgtgcaactgagccacgcaagtgggctgagttaattcgtcatgctggcgccatcttt
atgggtaattacaccagtgaatctttaggcgattattgtgcaggtccgaatcacgtttta
ccaacagcacgtactgcgcgcttctcatccccattgggggtgtatgactttattaagcgc
tcaagcatgattgaggtcagtgaagcaggtgctcaaacgctaggcgctgttgctagtacg
ctcgcacacggtgagggcttaacagctcacgcccgcgcagctgagatgcgcttgaaaaaa
taa

DBGET integrated database retrieval system