KEGG   Beta proteobacterium CB: D521_0141Help
Entry
D521_0141         CDS       T02483                                 

Definition
Putative thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bprc  Beta proteobacterium CB
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(126967..127683)
Genome map
AA seq 238 aa AA seqDB search
MNKLFSSLALACSLTFLAGMVNAQSEQQVRSELQKKIGPNTKIKGVSQSPIPGIYEVLVG
NDVFYTDANSKYLIQGEIIEIATGKNITEQKQADLNRIKWSELNFSNALKAVRGNGSRQI
AVFSDPNCGYCKRLEKSLQQLDNVTVYTYLIPILSPDSAQKSKQIWCSGDPQKAYIDWMI
NGIAPSGKGDCTTPLDKNMAFAKTYGITGTPTIFFTDGSRFPGAVQITDIEKKFSSLK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaattattttctagccttgctttagcttgctccctcacctttttagcgggaatg
gtcaatgcacaatcggagcaacaagttcgatctgaactacaaaagaagatcggccccaac
accaaaatcaaaggcgtttctcaatctcccattccaggcatatacgaggtcttggttgga
aatgatgtgttttataccgacgcaaacagcaaatacctcatccaaggtgaaatcattgag
atcgccacaggaaaaaatattacagaacaaaaacaagcagatctcaatcgcattaaatgg
tctgaactcaatttttcaaatgctttaaaagcagtccgcggcaatggcagtcgacagata
gccgttttctccgaccccaattgcggctactgcaagcgtttagaaaaatctttgcagcaa
ctagataacgttaccgtttacacctacttaattccgattttgtcacctgactctgcacag
aagtctaaacaaatttggtgctctggtgatccgcaaaaagcctatattgattggatgatc
aatggtattgcaccgagcggtaagggtgactgcactacccccttagataaaaatatggct
tttgccaaaacctacggcattacaggaaccccgactattttctttactgatggcagtcgc
tttccaggcgcggttcaaattaccgatattgaaaagaaatttagcagtctgaagtaa

DBGET integrated database retrieval system