KEGG   Beta proteobacterium CB: D521_0199Help
Entry
D521_0199         CDS       T02483                                 

Definition
Glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bprc  Beta proteobacterium CB
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bprc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    D521_0199
  Amino acid metabolism
   00330 Arginine and proline metabolism
    D521_0199
Enzymes [BR:bprc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     D521_0199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
184179..184961
Genome map
AA seq 260 aa AA seqDB search
MNTQKAKRIVVKVGSSLVTNNGEGLDRAAIGMWAEQMAALLASGHEVLMVSSGAIAEGMQ
RLGWSKRPTEIHQLQAAAAVGQMGLVQVYESCFARFNLRSAQVLLTNADLAHAERNANAK
ATLDTLLKLGVVPIINENDTVVTDEIKFGDNDSLAALVTNLIHADLLVILTDQGGLFTAD
PRQDASATLLSDATAGDPALEKMAGGAASELSKGGMLTKVLAAKVAAQTGAATVIASGRE
PQVLTRLMSGEKIGTCLTAA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaacactcagaaagctaaacgaatcgtagtgaaagtaggctcaagccttgtcaccaat
aatggtgagggcttagaccgtgctgcaattggtatgtgggctgaacaaatggccgccttg
ttagcttctggccatgaggtattaatggtgagttctggcgcaattgcagagggtatgcaa
cggctgggttggtctaagcgtccaacagaaattcatcagctacaggctgcagctgcagtt
ggtcaaatgggtttggttcaggtttatgagagttgttttgcgcgctttaatttacgtagc
gcgcaagtgctgttaactaatgcagatttggcacatgcagaacgtaatgcgaatgccaag
gcgaccttggataccttactaaagctcggcgttgttccaatcatcaatgaaaacgatacc
gtagttaccgatgaaattaaatttggtgataacgatagcttggcggctttagtaacgaat
ctaattcatgcggatttgttagtgatcttgactgatcaaggtggattatttactgctgat
ccgcgccaggatgcttctgctactttgttaagcgatgctactgctggtgatcctgcttta
gaaaagatggctggtggtgctgctagcgaactcagcaagggcggcatgttgaccaaagtg
ttggctgcgaaagttgccgctcaaacaggtgctgcaactgtcattgcctctgggcgtgag
cctcaggttctcactcgattgatgagtggcgaaaaaattggtacttgtctgactgctgct
taa

DBGET integrated database retrieval system