KEGG   Beta proteobacterium CB: D521_0302Help
Entry
D521_0302         CDS       T02483                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bprc  Beta proteobacterium CB
Pathway
bprc00790  Folate biosynthesis
bprc01100  Metabolic pathways
Module
bprc_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bprc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    D521_0302
Enzymes [BR:bprc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     D521_0302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI Mif2_N
Motif
Other DBs
NCBI-ProteinID: AGG32872
UniProt: M1T197
Position
276008..276799
Genome map
AA seq 263 aa AA seqDB search
MPTKKTPVKTVAKTPAKKTSSIKPVKKAIQKSTPKKSDAGTPLSIVIRRRIEAQKARFHA
NDNISKFIQPGELEGLVDEVAEKMQAVLESLVIDTESDHNTKNTSQRVAKMFVKEVFNGR
YVEQPTLTKFPNVSRLNELMIIGPITVRSACSHHLCPIMGRIWIGVLPSKESALIGLSKY
SRLTEWVMCRPQIQEEAVVELADMLEKKIKPIGVAIVMDADHFCMQWRGVKDRDSKMVNS
VMRGAFLKDSNLRREFLSLLDKR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcccactaaaaaaactcctgtgaaaacggttgccaagactcccgctaagaaaacctct
agcattaagcctgtcaagaaagctattcaaaaatccactccaaaaaagagcgatgctggc
acaccattgtctatagtgattcgtcgacgtattgaggcgcaaaaggcgcgcttccatgca
aatgacaatatctctaaattcattcagcctggtgaattagagggcttagtggatgaggtt
gcagaaaaaatgcaggctgttttagaaagcttggtgattgatacagagagtgatcacaac
actaaaaatactagccagcgtgttgcgaaaatgtttgttaaagaagtatttaatggccgt
tatgttgagcagcctacgctgactaaatttccgaatgtcagccgtttaaatgagttgatg
atcattggcccaatcaccgttcgtagtgcttgctcacaccacctttgcccaatcatgggt
cgcatttggattggcgtgttgccaagtaaagaatctgccttgattggcttatcaaagtac
tcacgccttactgagtgggtgatgtgtcgcccacaaattcaggaagaggcggtagttgaa
ttagcggacatgcttgagaaaaaaattaagcctattggcgtggcaatcgtgatggatgca
gatcacttctgcatgcaatggcgcggtgtaaaagatcgtgactcgaagatggtaaatagt
gtgatgcgtggggctttcttaaaggactccaatttgcgtagagagtttttatctcttctc
gataaaaggtag

DBGET integrated database retrieval system