KEGG   Beta proteobacterium CB: D521_0522Help
Entry
D521_0522         CDS       T02483                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bprc  Beta proteobacterium CB
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bprc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    D521_0522
Enzymes [BR:bprc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     D521_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
485508..486317
Genome map
AA seq 269 aa AA seqDB search
MSNKTIVITRPSGQARQLSEALQANLLNSGFTPEASPQIISLPLLTIAPKGDDVLAGQIR
KALKTADLAIFVSPNAIECTMRLLEQSWQGLSDKSVPIGVMGGSSMAALKNHGIGIEGSP
TKVILPQNNTQWDSEGLWLELQTLNWDWSSKRVIIFKGEGGRDWLAETLKNAGVHVEAFS
VYARVPLDLSSPAWNAIHEMDFAQSLWLLTSSEAVRYLGQAKLPLELAAAICPHHNIADA
AKQIGFGAVLTCEPGDEALIAASQAWLSI
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataagactattgtcattacccgccctagtgggcaagcgcgtcaattatcagaa
gcgcttcaggcaaatttactcaacagcggcttcactccagaagcctccccccagattatt
tccttacctcttctaacgattgctccgaagggcgatgatgttttggcggggcagataagg
aaagcgctgaagacggcagacttagcaatcttcgttagcccgaatgccattgaatgcacg
atgcgtttactcgaacaatcttggcaaggtttatctgacaagtctgtgcctattggggtt
atgggaggcagcagtatggccgccctcaaaaatcacggtattggtattgagggcagtcct
acaaaagttattcttcctcaaaacaatacgcaatgggattctgagggtctatggcttgaa
ttacagacactgaactgggattggtctagcaagagggtgatcattttcaagggcgaaggt
ggccgcgattggctggctgaaactttaaagaatgctggtgttcatgttgaagcattctca
gtgtatgcccgcgtacctttagatttaagcagccctgcctggaacgcaattcatgagatg
gattttgcacaatctctttggcttctcacatcatctgaggccgtacgctacttggggcaa
gcaaaattgccactcgaactagctgcagccatttgtccgcatcacaatattgccgatgct
gctaagcaaattggttttggtgcggtgttgacttgtgagcctggagatgaagctctcata
gccgcatcgcaagcttggctatctatttaa

DBGET integrated database retrieval system