KEGG   Beta proteobacterium CB: D521_1385Help
Entry
D521_1385         CDS       T02483                                 

Definition
aminotransferase AlaT
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
bprc  Beta proteobacterium CB
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bprc00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    D521_1385
   01230 Biosynthesis of amino acids
    D521_1385
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D521_1385
   00290 Valine, leucine and isoleucine biosynthesis
    D521_1385
Enzymes [BR:bprc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     D521_1385
    2.6.1.66  valine---pyruvate transaminase
     D521_1385
Amino acid related enzymes [BR:bprc01007]
 Aminotransferase (transaminase)
  Class I
   D521_1385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1357181..1358359)
Genome map
AA seq 392 aa AA seqDB search
MEEEGHKIIKLNIGNVGVFGFDPPEEIQLDMIRNLGNASAYSDSKGIFAARKAIMQYCQE
KGIQGVTLDDIYTGNGVSELIVLAMNALLNNGDEVLVPAPDYPLWTAAVSLSGGTPVHYL
CDESKDWAPDLADLRKKITPRTKAIVVINPNNPTGAIYSKEVLTELTSIAREHGLILFAD
EIYDKMLYDKEKHISLASLSTDVVTITFNGLSKNYRSCGYRAGWMVVSGDKEMIRDYIEG
LNMLSSMRLCANVPGQYAIQTALGGYQSINDLVNEGGRLAKQRDLAWKLITEIPGVTCVK
PKSALYLFPKLDSEMYPIEDDQQFVADLLKEEKVLLVQGSGFNWGKPDHFRVVFLPHEDV
LKEAISRLARFLERYRQKHSRKAANSTATKAS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagagggtcacaaaattatcaagctaaacatcggtaatgtgggtgtttttggc
tttgatcctccagaagagattcagttggacatgattcgtaatttgggtaatgcctcagcg
tactccgattcgaagggaatttttgcggctcgtaaggccatcatgcagtattgccaagaa
aaaggcattcagggcgttaccttggatgatatctacactggtaatggtgtttctgagttg
atcgtattggcaatgaacgcattgctcaataacggtgatgaagtcttggtgccagcacca
gactacccgttatggacagctgccgtcagcctgtctggcggtactcccgtccattacctc
tgtgacgagtctaaagattgggcacccgatttagcagatttgcgtaaaaagattacgcct
cgcactaaagcaattgtggtgatcaaccccaataatccaacgggcgccatttactccaaa
gaggtgcttacagagttaacatccatcgctcgtgagcatggattgatcctgtttgcagat
gagatttatgacaagatgttgtacgacaaagagaagcacatctccttggcatccttgtcc
actgatgtagtcactatcacctttaacggtttatccaaaaactaccgctcttgcggctac
cgtgctggctggatggtggtttctggggataaagagatgattcgcgattacatcgaaggt
ctcaatatgctgtcctcaatgcgcctgtgtgccaatgtgccaggccagtacgctattcaa
actgctttgggcggctaccaaagtattaatgatttggtcaatgagggtggtcgattggcc
aagcaacgcgatctcgcttggaaactcattactgagatccctggtgtaacttgcgttaag
ccaaagtccgccttgtacttatttccaaaactcgattccgagatgtatccgatcgaagat
gatcagcaatttgtagctgatcttttgaaagaagaaaaagtgttgttggtgcaaggctcc
ggttttaactggggcaagccagaccacttccgtgtagtgttcttacctcatgaggatgtg
cttaaagaggctattagccgtcttgcgcgttttcttgaacgttatcgtcaaaaacatagt
cgtaaagcggctaactcaacagcaacaaaggcatcatga

DBGET integrated database retrieval system