KEGG   Beta proteobacterium CB: D521_1385Help
Entry
D521_1385         CDS       T02483                                 

Definition
aminotransferase AlaT
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
bprc  Beta proteobacterium CB
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:bprc01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bprc01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bprc00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:bprc00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1357181..1358359)
Genome map
AA seq 392 aa AA seqDB search
MEEEGHKIIKLNIGNVGVFGFDPPEEIQLDMIRNLGNASAYSDSKGIFAARKAIMQYCQE
KGIQGVTLDDIYTGNGVSELIVLAMNALLNNGDEVLVPAPDYPLWTAAVSLSGGTPVHYL
CDESKDWAPDLADLRKKITPRTKAIVVINPNNPTGAIYSKEVLTELTSIAREHGLILFAD
EIYDKMLYDKEKHISLASLSTDVVTITFNGLSKNYRSCGYRAGWMVVSGDKEMIRDYIEG
LNMLSSMRLCANVPGQYAIQTALGGYQSINDLVNEGGRLAKQRDLAWKLITEIPGVTCVK
PKSALYLFPKLDSEMYPIEDDQQFVADLLKEEKVLLVQGSGFNWGKPDHFRVVFLPHEDV
LKEAISRLARFLERYRQKHSRKAANSTATKAS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagagggtcacaaaattatcaagctaaacatcggtaatgtgggtgtttttggc
tttgatcctccagaagagattcagttggacatgattcgtaatttgggtaatgcctcagcg
tactccgattcgaagggaatttttgcggctcgtaaggccatcatgcagtattgccaagaa
aaaggcattcagggcgttaccttggatgatatctacactggtaatggtgtttctgagttg
atcgtattggcaatgaacgcattgctcaataacggtgatgaagtcttggtgccagcacca
gactacccgttatggacagctgccgtcagcctgtctggcggtactcccgtccattacctc
tgtgacgagtctaaagattgggcacccgatttagcagatttgcgtaaaaagattacgcct
cgcactaaagcaattgtggtgatcaaccccaataatccaacgggcgccatttactccaaa
gaggtgcttacagagttaacatccatcgctcgtgagcatggattgatcctgtttgcagat
gagatttatgacaagatgttgtacgacaaagagaagcacatctccttggcatccttgtcc
actgatgtagtcactatcacctttaacggtttatccaaaaactaccgctcttgcggctac
cgtgctggctggatggtggtttctggggataaagagatgattcgcgattacatcgaaggt
ctcaatatgctgtcctcaatgcgcctgtgtgccaatgtgccaggccagtacgctattcaa
actgctttgggcggctaccaaagtattaatgatttggtcaatgagggtggtcgattggcc
aagcaacgcgatctcgcttggaaactcattactgagatccctggtgtaacttgcgttaag
ccaaagtccgccttgtacttatttccaaaactcgattccgagatgtatccgatcgaagat
gatcagcaatttgtagctgatcttttgaaagaagaaaaagtgttgttggtgcaaggctcc
ggttttaactggggcaagccagaccacttccgtgtagtgttcttacctcatgaggatgtg
cttaaagaggctattagccgtcttgcgcgttttcttgaacgttatcgtcaaaaacatagt
cgtaaagcggctaactcaacagcaacaaaggcatcatga

DBGET integrated database retrieval system