KEGG   Beta proteobacterium CB: D521_1385Help
Entry
D521_1385         CDS       T02483                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
bprc  Beta proteobacterium CB
Pathway
bprc00220  Arginine biosynthesis
bprc00250  Alanine, aspartate and glutamate metabolism
bprc00290  Valine, leucine and isoleucine biosynthesis
bprc01100  Metabolic pathways
bprc01110  Biosynthesis of secondary metabolites
bprc01130  Biosynthesis of antibiotics
bprc01210  2-Oxocarboxylic acid metabolism
bprc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bprc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D521_1385
   00290 Valine, leucine and isoleucine biosynthesis
    D521_1385
   00220 Arginine biosynthesis
    D521_1385
Enzymes [BR:bprc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     D521_1385
    2.6.1.66  valine---pyruvate transaminase
     D521_1385
Amino acid related enzymes [BR:bprc01007]
 Aminotransferase (transaminase)
  Class I
   D521_1385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Alliinase_C Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGG33953
UniProt: M1SPJ5
Position
complement(1357181..1358359)
Genome map
AA seq 392 aa AA seqDB search
MEEEGHKIIKLNIGNVGVFGFDPPEEIQLDMIRNLGNASAYSDSKGIFAARKAIMQYCQE
KGIQGVTLDDIYTGNGVSELIVLAMNALLNNGDEVLVPAPDYPLWTAAVSLSGGTPVHYL
CDESKDWAPDLADLRKKITPRTKAIVVINPNNPTGAIYSKEVLTELTSIAREHGLILFAD
EIYDKMLYDKEKHISLASLSTDVVTITFNGLSKNYRSCGYRAGWMVVSGDKEMIRDYIEG
LNMLSSMRLCANVPGQYAIQTALGGYQSINDLVNEGGRLAKQRDLAWKLITEIPGVTCVK
PKSALYLFPKLDSEMYPIEDDQQFVADLLKEEKVLLVQGSGFNWGKPDHFRVVFLPHEDV
LKEAISRLARFLERYRQKHSRKAANSTATKAS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagagggtcacaaaattatcaagctaaacatcggtaatgtgggtgtttttggc
tttgatcctccagaagagattcagttggacatgattcgtaatttgggtaatgcctcagcg
tactccgattcgaagggaatttttgcggctcgtaaggccatcatgcagtattgccaagaa
aaaggcattcagggcgttaccttggatgatatctacactggtaatggtgtttctgagttg
atcgtattggcaatgaacgcattgctcaataacggtgatgaagtcttggtgccagcacca
gactacccgttatggacagctgccgtcagcctgtctggcggtactcccgtccattacctc
tgtgacgagtctaaagattgggcacccgatttagcagatttgcgtaaaaagattacgcct
cgcactaaagcaattgtggtgatcaaccccaataatccaacgggcgccatttactccaaa
gaggtgcttacagagttaacatccatcgctcgtgagcatggattgatcctgtttgcagat
gagatttatgacaagatgttgtacgacaaagagaagcacatctccttggcatccttgtcc
actgatgtagtcactatcacctttaacggtttatccaaaaactaccgctcttgcggctac
cgtgctggctggatggtggtttctggggataaagagatgattcgcgattacatcgaaggt
ctcaatatgctgtcctcaatgcgcctgtgtgccaatgtgccaggccagtacgctattcaa
actgctttgggcggctaccaaagtattaatgatttggtcaatgagggtggtcgattggcc
aagcaacgcgatctcgcttggaaactcattactgagatccctggtgtaacttgcgttaag
ccaaagtccgccttgtacttatttccaaaactcgattccgagatgtatccgatcgaagat
gatcagcaatttgtagctgatcttttgaaagaagaaaaagtgttgttggtgcaaggctcc
ggttttaactggggcaagccagaccacttccgtgtagtgttcttacctcatgaggatgtg
cttaaagaggctattagccgtcttgcgcgttttcttgaacgttatcgtcaaaaacatagt
cgtaaagcggctaactcaacagcaacaaaggcatcatga

DBGET integrated database retrieval system