KEGG   Beta proteobacterium CB: D521_1914Help
Entry
D521_1914         CDS       T02483                                 

Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bprc  Beta proteobacterium CB
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bprc03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1868294..1869130)
Genome map
AA seq 278 aa AA seqDB search
MPELPEVEVTRLGIAPHLEGHRVSAVKIIDGRLRWPVPSNLNALLSGQKVLGIERRGKYL
LMELDTGYLLLHLGMTGTLRVLPNGDPLKPHDRVTFEFGKLSLRLHDPRKFGAVLWHPKS
KGPIENNVLLQKLGVEPFSPEFSGELGVDVLYECSRKRSVAVKQFLLSGQAVVGVGNIYC
SESLFEAGIHPAKAAGKLTRPQCSRLAAAVRLILKKAIAAGGSSLKDFVNSEGDPGHFMV
QTKVYDRKDQPCKVCKTPIKQIVQGQRSTYFCPQCQKR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgccagaactcccagaagtcgaagttacccgattgggtattgcaccccatttagagggt
catagagtgagtgccgtcaaaattattgatggtcgtttgcgttggccagttcccagcaat
ctcaatgctttactttctggccagaaggttttgggaatagagcgccgtggtaagtatctt
ttaatggagttagatactggatacctgttgctgcacttaggcatgacaggaacattgcgc
gtgcttcctaatggcgatcctctgaagccgcatgatcgtgtaacttttgagtttggcaag
ctcagtttgcgtctgcatgatccccgcaagtttggcgcagttttatggcacccaaaatct
aaagggccgattgagaacaacgtgctcttgcaaaaactcggggttgagccgttttcgcca
gagttttcgggtgagcttggcgtagatgtcttatatgaatgctcgcgtaagcgtagtgtt
gctgtgaagcaatttttactgtcagggcaagcagtggttggtgttggcaacatctattgc
tcagaaagcttattcgaggctggtatccatccagcaaaggctgctggaaaattaactcgc
cctcaatgctctcggctcgctgctgcagtgagattgattttgaaaaaagcgattgctgca
ggtggtagttctttaaaagacttcgtgaacagtgaaggtgacccaggacacttcatggtg
caaaccaaagtctacgatcgcaaagatcagccttgcaaggtatgcaagacgccgattaaa
caaatagtgcaaggtcagcgttctacttatttttgcccccaatgtcagaagcgctga

DBGET integrated database retrieval system