KEGG   Butyrate-producing bacterium SSC/2: CL2_07860Help
Entry
CL2_07860         CDS       T02612                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bprl  Butyrate-producing bacterium SSC/2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bprl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CL2_07860
Enzymes [BR:bprl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CL2_07860
Exosome [BR:bprl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CL2_07860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(755123..757351)
Genome map
AA seq 742 aa AA seqDB search
MNETINREDLYLFQTGKARQAYLTFGCHYQKKTKTHRFTVWAPNAKSVSVVGDFNFWNPL
AHPMKGDKDGIYTIEIEGLKKGDLYKYHVEGYDGICRYKSDPFAFYAECRPDTASKVWDF
DDFKWSDKRFINQRKKRQALDQPMSIYELHLGTWRMPQEEEREFYNYREIADMLIPYLGE
MGYTHVELMPITEYPYDLSWGYQVTGYYGVTSRYGTPEDFNYMINELHKAGISVILDWVP
AHFPRDEHGLAMFDGTHIYDHEDPRKGSQPDWGTLLFNYGKPEVQSFLISSAMFFADIYH
IDGIRIDAVSAMLYLDFGKQEGEYVPNEDGTNINYEAVDFLRNLNEALRTTHEGFLTIAE
ESTAYPKVTSDVDDPEGLGFVYKWNMGYMHDTLYYMELDPLYRKDNHGAIIFSMDYAYSE
NYILPYSHDEVVHGKGSMINKMYGAYDEKFASLRTLYGFTMAHPGKKLLFMGGEFAQFVE
WRDKEQLDWFLIDQYEMHDSFHKYVAKLNEIYKSEPALYELDQDPAGFEWCLQRDADHSV
VAFIRKNKKGRGRKQQQILCVCNFTPMEWDKYKVPLPKKSKLTKILDSSELDFGGDGDVS
ESKVSTKRVKVPSEGKKAVYQQAAEISLKPLSVVYYKIEEVETKSRKSVAKKAEPAKKAT
AKKAEPAKKAAQEKKTEAVKKTVEKKPEVTKKVTKEEAPETKKDTPKKEDIKVTKQTTEK
EEEQPKKEQARQEEQKRIMIKV
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaactatcaatcgtgaggatttgtatttgtttcagacgggaaaggcaaggcag
gcatacctgacatttggatgccattatcagaagaagacaaagactcacagatttactgtt
tgggctccaaatgcaaagtcagtcagtgtcgtaggtgatttcaatttctggaatcctctt
gcgcatccgatgaaaggtgacaaagacgggatctatacgatcgagattgaaggactgaag
aaaggtgatctgtataaatatcatgtagaaggctatgatggaatctgcagatataagagt
gatccttttgcattttatgcagaatgcagaccagatacagcttcgaaagtctgggatttc
gatgattttaaatggtctgataaacgttttatcaatcagaggaagaaacgccaggcatta
gatcagccaatgtctatctatgagctgcatcttggaacatggagaatgccgcaggaagaa
gagagagaattttataattatcgtgagattgcggacatgctgattccttatcttggagag
atgggatatacacatgttgaactgatgccgatcacagaatatccatatgatctttcttgg
ggatatcaggtaacaggatattacggtgtaacatcaagatatggaacaccagaagatttc
aattatatgatcaatgagttacataaagcagggatcagtgtcatccttgactgggtccca
gcacattttccaagagatgaacatggactggcaatgtttgatggaacgcatatttatgat
catgaggatccaaggaagggaagccagcctgactggggaactttattatttaactatggg
aaaccagaagtacagagcttcttgatctcaagtgcgatgttctttgcagatatttatcat
atcgatggaattcgtattgatgctgtatctgcaatgctatatcttgactttgggaaacag
gaaggagaatatgtgccgaatgaagatggaaccaatatcaactatgaagcagttgatttc
cttcgcaatctaaacgaagcacttcgtacaacacatgagggattcttgacgatcgcagaa
gaatcaacagcatatccaaaggtaacaagtgatgttgatgatccggaaggactaggattt
gtttacaagtggaatatgggatatatgcatgatactctttactatatggaacttgatcca
ttgtatcgtaaggataatcatggagcgatcattttctctatggattatgcttacagtgag
aattacattcttccatattcacatgatgaggttgttcatggcaaaggttctatgatcaat
aagatgtatggtgcatatgatgagaagtttgcttcactgcgaacattatatggatttacc
atggcacatccaggaaagaaattattatttatgggtggagaattcgcccaatttgtagaa
tggagagacaaagaacagcttgattggttcttgatcgatcagtatgagatgcatgattct
ttccacaaatatgtagctaaactaaatgagatttacaaatctgaaccggcattatatgaa
ttagatcaggatccagcaggatttgaatggtgcttgcaacgtgatgcagaccacagtgtt
gtagcatttatacgaaagaataagaagggcagaggaagaaaacaacaacagattctttgt
gtctgcaattttacaccgatggaatgggataaatacaaggtaccattaccaaagaaatca
aaacttacgaagatcttagacagcagtgagcttgattttggtggagatggagatgtttcc
gaatctaaagtttcaacgaagagggtgaaagtaccatctgaaggaaagaaagctgtttac
caacaggcagcagaaatttccttaaaaccattaagtgttgtttactataagatcgaggaa
gtggagacgaaatcacgaaagagtgtagcaaagaaagcagagccggcaaagaaagccact
gcaaagaaagcagagccagcaaagaaggcagcacaggagaagaaaacagaagctgtgaag
aaaacagtagagaaaaagccggaagttacaaagaaagtaacaaaagaagaggcgccggag
actaagaaagacactcccaaaaaagaagatataaaggtaacaaagcaaacaacagagaaa
gaagaggaacagccaaaaaaagaacaagcaagacaagaagaacaaaaaagaataatgatc
aaggtgtaa

DBGET integrated database retrieval system