KEGG   Butyrate-producing bacterium SSC/2: CL2_12120Help
Entry
CL2_12120         CDS       T02612                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bprl  Butyrate-producing bacterium SSC/2
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bprl01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bprl00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1209039..1210373
Genome map
AA seq 444 aa AA seqDB search
MKKNRPEERNMRIVKVNKDSIANILSDLLKRSPTNYGDFQDKVDAIIKNVRDNGDKAVFD
YTAQFDKAEINADNILVTEEEIKEAYEEVDDELIKVIRKAIKNIRDFHEKQIQKSWFETR
EDGVMLGQKVTPMETCGVYVPGGKAVYPSSVLMNIVPAHVAGVKNIIMTTPPGKDGKVTA
NTLVAAKEAGATKVYKVGGAQAIAAMAFGTESIPKVDKIVGPGNIFVALAKKAVYGNVSI
DSIAGPSEILVLADETANPRYVAADLLSQAEHDEMASAILVTTSEELAHKVSDEIDGFLN
QLSRKEIMEKSLDSFGYILVASDMKEAIDTANAIASEHMEIMTANPFDVMTRIKNAGAIF
IGAYSCEPLGDYFAGPNHVLPTNGTAKFFSPLSVDDFIKKSSVIYYSREALEPVHKDIEF
FANQEQLTAHANSMKVRFEDNQEG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaataggccggaggagagaaatatgagaatagtaaaagttaacaaagattcc
attgcaaatattttatcagatttattaaagagaagtcctacaaactatggggattttcag
gataaagtcgatgcgatcatcaaaaatgtcagagataatggagataaagctgtctttgat
tatacagcacagtttgataaagcggagatcaacgcagacaatattttagttacagaagaa
gaaattaaggaagcttacgaagaagtggacgatgaattgatcaaagttatccgcaaagcg
atcaagaatattcgtgatttccatgaaaaacagattcagaagagctggtttgagacaaga
gaagacggagtaatgcttggacagaaagtaacaccaatggaaacttgtggtgtctatgta
ccaggtggaaaagcagtttatccatcttctgttttaatgaacattgttccagcacacgtt
gcaggagtgaaaaatatcatcatgacaacacctcctggaaaagacggaaaagttacagca
aatacattagttgcagcgaaagaagctggagcaacaaaagtatataaagtcggtggagca
caggcaattgcagcgatggcatttggaacagagtctattccaaaagtagacaagatcgta
ggacctggtaacatttttgtggctcttgccaagaaagcagtttatggaaacgtaagtatc
gattccattgcaggaccaagtgagatcttagtgttagctgatgagacagcgaatccaaga
tatgtggcagcagacttactttcccaggcagaacatgatgagatggcaagtgcgatcctt
gttacaacaagcgaagaattagcacataaagtatctgatgagattgacggattcttaaat
cagttatcaagaaaagagatcatggagaaatctttagattccttcggatatattcttgtt
gcaagcgatatgaaagaagcaattgatacggcaaacgctattgcgtctgaacatatggag
atcatgacagcaaatccatttgatgttatgacaaggatcaagaatgcaggagcgatcttt
atcggagcatacagctgtgaacctttaggagattattttgcaggaccaaaccacgtactt
ccaacaaatggaacagcgaaattcttctctccattaagtgttgatgatttcatcaagaaa
tcaagtgtcatctactattcaagagaagccttagagccagtacacaaagacatcgaattc
tttgcgaatcaggaacagctgacagcacatgctaattccatgaaagtaagatttgaagat
aaccaggaaggataa

DBGET integrated database retrieval system