KEGG   Butyrate-producing bacterium SSC/2: CL2_12120Help
Entry
CL2_12120         CDS       T02612                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bprl  Butyrate-producing bacterium SSC/2
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bprl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CL2_12120
  Amino acid metabolism
   00340 Histidine metabolism
    CL2_12120
Enzymes [BR:bprl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CL2_12120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1209039..1210373
Genome map
AA seq 444 aa AA seqDB search
MKKNRPEERNMRIVKVNKDSIANILSDLLKRSPTNYGDFQDKVDAIIKNVRDNGDKAVFD
YTAQFDKAEINADNILVTEEEIKEAYEEVDDELIKVIRKAIKNIRDFHEKQIQKSWFETR
EDGVMLGQKVTPMETCGVYVPGGKAVYPSSVLMNIVPAHVAGVKNIIMTTPPGKDGKVTA
NTLVAAKEAGATKVYKVGGAQAIAAMAFGTESIPKVDKIVGPGNIFVALAKKAVYGNVSI
DSIAGPSEILVLADETANPRYVAADLLSQAEHDEMASAILVTTSEELAHKVSDEIDGFLN
QLSRKEIMEKSLDSFGYILVASDMKEAIDTANAIASEHMEIMTANPFDVMTRIKNAGAIF
IGAYSCEPLGDYFAGPNHVLPTNGTAKFFSPLSVDDFIKKSSVIYYSREALEPVHKDIEF
FANQEQLTAHANSMKVRFEDNQEG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaataggccggaggagagaaatatgagaatagtaaaagttaacaaagattcc
attgcaaatattttatcagatttattaaagagaagtcctacaaactatggggattttcag
gataaagtcgatgcgatcatcaaaaatgtcagagataatggagataaagctgtctttgat
tatacagcacagtttgataaagcggagatcaacgcagacaatattttagttacagaagaa
gaaattaaggaagcttacgaagaagtggacgatgaattgatcaaagttatccgcaaagcg
atcaagaatattcgtgatttccatgaaaaacagattcagaagagctggtttgagacaaga
gaagacggagtaatgcttggacagaaagtaacaccaatggaaacttgtggtgtctatgta
ccaggtggaaaagcagtttatccatcttctgttttaatgaacattgttccagcacacgtt
gcaggagtgaaaaatatcatcatgacaacacctcctggaaaagacggaaaagttacagca
aatacattagttgcagcgaaagaagctggagcaacaaaagtatataaagtcggtggagca
caggcaattgcagcgatggcatttggaacagagtctattccaaaagtagacaagatcgta
ggacctggtaacatttttgtggctcttgccaagaaagcagtttatggaaacgtaagtatc
gattccattgcaggaccaagtgagatcttagtgttagctgatgagacagcgaatccaaga
tatgtggcagcagacttactttcccaggcagaacatgatgagatggcaagtgcgatcctt
gttacaacaagcgaagaattagcacataaagtatctgatgagattgacggattcttaaat
cagttatcaagaaaagagatcatggagaaatctttagattccttcggatatattcttgtt
gcaagcgatatgaaagaagcaattgatacggcaaacgctattgcgtctgaacatatggag
atcatgacagcaaatccatttgatgttatgacaaggatcaagaatgcaggagcgatcttt
atcggagcatacagctgtgaacctttaggagattattttgcaggaccaaaccacgtactt
ccaacaaatggaacagcgaaattcttctctccattaagtgttgatgatttcatcaagaaa
tcaagtgtcatctactattcaagagaagccttagagccagtacacaaagacatcgaattc
tttgcgaatcaggaacagctgacagcacatgctaattccatgaaagtaagatttgaagat
aaccaggaaggataa

DBGET integrated database retrieval system