KEGG   Butyrate-producing bacterium SSC/2: CL2_12260Help
Entry
CL2_12260         CDS       T02612                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bprl  Butyrate-producing bacterium SSC/2
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bprl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CL2_12260
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CL2_12260
Enzymes [BR:bprl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CL2_12260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1222807..1223661
Genome map
AA seq 284 aa AA seqDB search
MNNREKLKDKQRIVVKVGTSSLIHKATGNINLFRLEKLVRVLTDLHNSGKDVILVSSGAI
GVGFKALGLENRPTSLPMKQACSAVGQGQLMMIYQKLFAEYNQGSAQILITKETMLNDER
RYNAKNTFEELLKLGVIPIVNENDTVSTEEIEFGDNDTLSAVVTAVVQGDLLILLTDIDG
LYTDDPHKNPLAKLIPEVPVLDEKIGRMAKGAVTKVGTGGMETKIAAANIVTDAGADMVI
VNSNNLNNVNKVVAGEEIGTLFLAHKRPDFDFKKYLTERPYFKA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcgtgaaaaactaaaagataaacaaagaattgtcgtcaaagtaggtacatct
tctttgatccataaagcaacaggaaacatcaatttattccgattagagaaattagtccgt
gttttaacagacttacataacagcggaaaagacgtgatcctggtatcttcaggagcgatt
ggtgtaggatttaaagccctgggattagaaaaccgtccgacatcccttccaatgaagcag
gcatgttctgctgtaggacagggacagttaatgatgatctaccagaaactgtttgctgaa
tacaatcagggatctgcacagattctgatcacaaaagagacgatgctcaatgacgagaga
agatataacgccaagaatacatttgaagaattactaaaactcggcgtgatcccgatcgta
aatgaaaacgatacggtatctacagaagagatcgagtttggtgacaatgataccttatct
gcagtcgtaactgcagttgtacaaggtgatctattgattctcctgacagatattgacgga
ctttatacggatgacccacacaagaatccactggccaaactgatcccagaagtaccagtc
ttagatgaaaagattggaagaatggcaaaaggagctgtaactaaggtcggaactggcgga
atggaaacaaagatcgcagcagccaatatcgtaacagatgctggagcagatatggtgatc
gtaaacagcaataatttaaataatgtcaataaagttgttgcaggagaagagatcggaaca
ttattcttagcacacaaacgaccagactttgatttcaagaaatatttaacagaacgccca
tattttaaggcataa

DBGET integrated database retrieval system