KEGG   Butyrate-producing bacterium SSC/2: CL2_21990Help
Entry
CL2_21990         CDS       T02612                                 

Definition
Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases (EC:5.1.3.4)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bprl  Butyrate-producing bacterium SSC/2
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bprl00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CL2_21990
Enzymes [BR:bprl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CL2_21990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2188967..2189635
Genome map
AA seq 222 aa AA seqDB search
MLESLKKDVVAMAKRAQKEGLCKHLSGNLSARDPETGYVVITPTQVDRDLLTARDMVVLD
LDANVIENESGLRPTSESLMHLQIYKTRPDVNAICHTHSMYATTFAVLNKPIPAVVYEIA
NLGVTKSRIPVAPYGRPGTTDLSDSVIEPVQEADVFLLQGHGAVAVSQGDIYDAYLRAAY
IEELAQLYYNALCAGQGEEPYFFPPEELQKWEYPSQIKFPNK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttagaatcattaaaaaaagacgttgtagctatggcaaaacgtgctcaaaaagaagga
ttatgtaaacatttatctggaaacttaagtgcaagagatccagaaacaggatatgtagtg
atcacaccaacacaggtagatagagatttattaacagcaagagatatggttgttcttgat
cttgatgcaaacgttatcgaaaatgaatcaggacttcgtccaacaagtgaatctttaatg
catcttcagatttacaaaacaagaccagatgtgaatgcaatctgccatacacattctatg
tatgcaacaacattcgctgtattaaacaaaccaattccagcggttgtatatgaaattgct
aacttaggtgtaacaaaatccagaatcccagtagctccttacggacgtccaggaacaaca
gatctgtctgatagtgttattgaaccagttcaggaagcagacgtattcttattacaggga
catggagcagtggctgtatctcagggtgacatctatgatgcatacttaagagctgcttat
atcgaagaattagctcagttatactacaatgcactttgtgcaggacagggcgaagaacca
tacttcttcccaccagaagaattacagaaatgggagtatccatctcagatcaaattccct
aacaaataa

DBGET integrated database retrieval system