KEGG   Butyrate-producing bacterium SSC/2: CL2_23310Help
Entry
CL2_23310         CDS       T02612                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bprl  Butyrate-producing bacterium SSC/2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bprl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CL2_23310
Enzymes [BR:bprl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CL2_23310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2315754..2317187
Genome map
AA seq 477 aa AA seqDB search
MKTSGILLPIFSLPSDYGIGCFSKEAYKFVDFLEEAGQKYWQILPLGTIGAGNSPYLSFS
SFAGSAYYIDLEQLLEEGLLKKKELESIKEENKGKVDYEKIREDHRKLLRKAYFRFHPDE
DYKKFIKDNEYWIGEYAEYMSEKKSKFPESYFCFCQYYFHKQWLALKKYANDKGIQIVGD
LPFYVALDGTAFTYHKELFKVDEEGKATVVGGCPPDAFAEDGQVWSNPVYDWEYHKKTDY
EWWMKRLRHNFMLYDILRLDHFRGFDEYFEIPAEDETAVNGEWVKGPGMDFFEAMKKELG
EKKVIAENLGFLTDSVHKLLDDTGFPGMNVLEFAFGAYDDSIYLPHKYKENSVVYTGTHD
NDTVVGWYETLSEDDKKFLEHYLKYSTIERTGTVHLDLISLALESRSDMVIIPLQDYLGL
GNEARINTPSTVGGNWEWRVKEEQLTDELKELIRTLTIKYRTVAEENAKKAAEEAQQ
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaagcggaatattattgccaatttttagtttaccatcagattacggaattgga
tgcttttcaaaggaagcatacaaatttgtagattttttagaagaagcaggccagaagtac
tggcagatccttccattaggaacgatcggtgcgggaaattctccttatctttcgttttca
agttttgcaggaagtgcatattatatcgacttagaacagttactggaagaaggacttctt
aagaaaaaagaactcgaatcaattaaggaagaaaacaagggcaaagttgactatgagaaa
atcagagaagatcacagaaagcttttaagaaaagcttatttcagatttcatccagatgaa
gattataagaaatttatcaaagacaatgaatactggatcggggaatatgcagaatatatg
agcgagaagaaaagtaaattcccagaaagttatttctgcttctgccagtattatttccat
aaacagtggcttgcgctgaagaaatatgcgaatgacaaaggaattcagatcgtaggagat
cttccattttatgtagccttagatggaacagcatttacataccacaaagaattatttaaa
gtcgatgaagaaggaaaggcaacggttgtaggtggatgtcctccagatgcatttgcagaa
gatggacaggtatggtccaatcctgtatatgactgggaatatcataagaaaacagattac
gaatggtggatgaaacgtttacgtcataattttatgttatatgatattttaagattagac
catttcagaggattcgatgaatactttgagattccagcagaagacgagacagctgttaat
ggagaatgggtcaaaggtccaggaatggatttctttgaagcaatgaagaaagaacttggt
gagaagaaagttatcgcagagaacttaggattcttaacagacagcgtgcataaacttcta
gatgatacaggattcccaggaatgaatgttctggaatttgcatttggagcatatgatgac
agcatctatcttccacataaatacaaagaaaatagtgttgtatacacaggaacacatgac
aatgatacggttgttggatggtacgaaacattatcagaagatgataagaaattcttagag
cattatttaaaatacagtacgatcgagagaacaggaactgtacatttagacttgatttct
cttgcattagagagtcgaagcgatatggtgatcatcccacttcaggattatcttggatta
ggaaatgaagcaaggatcaacacaccatctacggtaggtggtaactgggagtggagagtg
aaagaagagcagttaacagatgagttaaaagaactgatcagaacactgacaataaaatat
cgtacagttgcagaagagaatgcgaagaaagcagccgaagaagcacagcaatag

DBGET integrated database retrieval system