KEGG   Butyrate-producing bacterium SSC/2: CL2_28600Help
Entry
CL2_28600         CDS       T02612                                 

Definition
Sugar kinases, ribokinase family (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bprl  Butyrate-producing bacterium SSC/2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bprl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CL2_28600
Enzymes [BR:bprl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CL2_28600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2850604..2851506
Genome map
AA seq 300 aa AA seqDB search
MKILSFGSLNIDYVYKVSHFVKKGETLSAEELNVYTGGKGLNQSIALSRAGMETYHAGAI
GMDGLFLLDQLKEAGVNTDLVKILEDVRTGNAIIQNDEEGDNCIILFGGANQAISKEQVD
EVFEHFKNEDYLLIQNEINELPYIVKKAKEIGMKIILNPSPMNEKIKELPLDQINYFLLN
EIEAMQILDMEEPKEIDGKYISGLLHQKFPKATIVLTLGSEGSVCISGDEYVEQSIYKVK
TVDTTAAGDTYTGYFIAGILNGKTIKEAMDTASKASAIAVSRQGAAPSIPYLKEVEEYKN
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattatcatttggatcattaaatattgactatgtatataaagtttctcatttt
gtgaaaaaaggagaaacattgtctgcagaagagttgaacgtatatacaggcggaaaagga
ttaaaccagtccattgcactttcacgtgcaggaatggaaacatatcatgcaggagcgatt
ggcatggatggactatttttgttagatcaattaaaagaagcaggagtaaatacagatctt
gttaagatccttgaagacgtaagaacaggaaatgcgatcatacaaaatgatgaagagggc
gataactgtattattctatttggaggagctaatcaggcaatcagtaaggaacaagtagat
gaagtctttgaacattttaaaaacgaagattatttactgatccaaaatgagatcaatgaa
cttccatatattgtaaagaaagcaaaagaaattggaatgaagatcattttaaatccatct
ccaatgaatgagaagataaaagaacttccactagatcagattaactattttcttttaaat
gaaatagaagcaatgcagattcttgatatggaagaaccaaaagaaattgatgggaaatat
attagtggtctgttacatcagaaattcccaaaagcaaccatcgtattaactttaggaagt
gaaggatctgtatgtatatctggtgatgaatatgtggaacagtcaatttataaggtaaag
acagtcgatacaacggcagcaggagatacctataccggatattttattgcaggtatctta
aatggaaaaacgatcaaagaagcaatggataccgcatccaaagcatcagcaattgcagta
agcagacaaggggcagccccatccattccatatctgaaagaagtagaagaatataaaaat
tag

DBGET integrated database retrieval system