KEGG   Butyrate-producing bacterium SM4/1: CL3_08060Help
Entry
CL3_08060         CDS       T02610                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bprm  Butyrate-producing bacterium SM4/1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bprm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
703638..705137
Genome map
AA seq 499 aa AA seqDB search
MTTMLKRGAGILMPISSLPAPYGIGTFGKSAYEFADSLKRARQSYWQVLPLGPTSYGDSP
YQSFSAFAGNPYFIDLDALLEEELLTKEEIDACYWLDSEEEVKYDAVYYYRFPLLKKAYE
RSRHGETEEYRAFCAKNSHWLDDYALYMALKGHFGNKEWMKWEEPIRLRKPEAVKRYEEL
LREEIGYWKFLQFKFYEQWEQLKNYVNGLGISIIGDIPIYVALDSADVWTHPELFQLDPD
TLTPLRVAGVPPDAFSDDGQLWGNPLYDWDKIEETGFAWWKDRMRASARLYDVVRIDHFI
GVVQYYSIPYGAEDGKTGEWKQGPGKKLTDAINEAAGDAKIIAEDLGIFCPAVKELLRKT
GYPGMKIIEFAFSGDRFNEHLPHCYEPNSVVYGGTHDNETLVGYFKPEARQWWELQYIAD
YLGAAHHEEVPDKVFRAAYGSVASVAVFQMQDVLGLGNEARMNTPGTVGGNWKWRMKPGA
FGERETGYLAFLVDTFGRF
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaatgctgaagcggggcgcgggcatccttatgcccatttccagccttccggct
ccatatggaatcggcacctttggaaagagcgcctatgaatttgcagacagtctgaaacgg
gcaagacagagctactggcaggtgctgcccctgggacccaccagctatggggacagcccg
tatcagtctttttctgcctttgcaggaaatccgtacttcattgatctggacgcgcttctt
gaggaagagcttctgacgaaggaggagattgacgcctgctactggttggacagcgaggag
gaggtcaaatatgacgcggtctattattaccgctttccgctgctgaaaaaagcctatgag
agaagccgtcacggggagacagaggagtaccgggcattctgtgctaaaaacagtcactgg
ctggacgattatgccctctacatggctctgaaaggccatttcggcaataaagagtggatg
aaatgggaggagcccatccggctcagaaaaccggaggctgtaaaaaggtatgaggaactt
ctgagggaggagattggctactggaagtttctgcagtttaagttttatgagcagtgggaa
cagctgaagaattatgtcaacgggctgggcatcagcataatcggagacatcccgatctat
gtggccctggacagcgcggatgtgtggacccatccggagctgttccagctggatccggat
acgctgacacccctcagagtggcgggcgttccgccggatgccttttctgatgacggccag
ctctgggggaacccgctctacgactgggataaaatcgaggaaaccggctttgcctggtgg
aaggacaggatgagggcttctgccagactctacgatgtggtgcggatcgatcatttcatc
ggtgtggtgcagtattattcgattccctacggggcagaggacggaaagacgggagagtgg
aagcagggaccaggaaagaagctgacggatgccatcaatgaggcggccggggacgcaaag
atcattgctgaagatctgggaatcttctgcccggcggtcaaggagcttctgcggaagact
ggatacccgggaatgaaaatcatcgagtttgccttcagcggcgaccggtttaacgagcat
ctgccccactgttatgagccaaactccgtggtttacggaggaactcatgacaatgagaca
ctggtgggctactttaagccggaggcaaggcagtggtgggagctgcagtatattgcggat
tatctgggagcagcacaccacgaggaggtgcctgacaaggtgttccgggcagcctatggc
tcggttgccagtgtggcagttttccagatgcaggatgtcctcgggctgggaaatgaggcc
agaatgaatacgccgggaacggttggaggaaactggaagtggaggatgaagccgggagcc
ttcggagagagggagacagggtatctggccttcctggtagacacattcggaaggttttaa

DBGET integrated database retrieval system