KEGG   Butyrate-producing bacterium SM4/1: CL3_16540Help
Entry
CL3_16540         CDS       T02610                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bprm  Butyrate-producing bacterium SM4/1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bprm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1445926..1447899
Genome map
AA seq 657 aa AA seqDB search
MNTTTDTKSFGKDQYMKKTAGQKTKTPKAGMGFFGELDLYLFGEGRHYRLYEKMGAHPYT
YRKKAGMHFAVWAPHAQSVSVVGDFNGWNPEKNPMKNINGQGIYEAFVPDLKEGELYKYA
VTTQTGSLLLKSDPFAFSAEYRPGTASVTSDITGFSWSDSAWMEKRKQTDPVKAPLAIYE
VHLGSWRKTIRPERDNCYTYREAAKALADYVKHMGYTHVELMGIAEHPFDGSWGYQVTGY
YAPTSRYGAPKDFMYLVNYLHKKGIGVILDWVPAHFPRDAHGLADFDGEPLYEYADPRKG
EHPDWGTKVFDYGKNEVKNFLIANALYWIEQYHIDGLRVDAVASMLYLDYGRKDGEWVAN
QYGGNQNLEAIEFFKHLNSVLTGRKDGCMIIAEESTAWPKVTHRPEDDGLGFTFKWNMGW
MHDFLEYMKLDPIYRKFNHNHMTFGLTYSTSENFILVLSHDEVVHLKCSMINKMPGIYED
KFANLKAGYTFMLGHPGKKLLFMGQDFGQFHEWDEKVSLDWYLADEPLHADLQSYVRGLL
TLYRKYPCLSRLDNDYAGFQWINANDADRSIFSFVRRDETKKKNLLFIINFTPVERADYR
VGVPKRGNFTLVLDSHHGYYEKNDDVHVYRSKKGECDGQPYSFSYPLPPYGTAVFRF
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaacaacagataccaaatcttttggcaaggaccagtacatgaaaaaaacggcc
gggcaaaagacaaaaactccaaaagcaggaatgggattttttggtgaactcgacctctac
ctgttcggtgagggacgccattaccgtctctatgaaaagatgggagcccacccttacacc
taccggaaaaaagccggcatgcactttgccgtatgggcgcctcacgcacagtccgtaagc
gtagtaggggatttcaacggatggaatcccgaaaaaaatcccatgaaaaatatcaatgga
cagggaatttatgaggcctttgtgcctgatttaaaggagggcgagctctataaatacgct
gtcaccacccaaacgggctctctgctcttaaaatccgatccctttgccttcagcgccgaa
taccggccgggaactgcctctgtaacttctgacattacaggcttttcctggagcgactcc
gcctggatggaaaagaggaagcagacagaccctgtcaaggctcccctcgcaatctacgag
gtgcatctggggtcctggcgaaaaaccatccgtccggagcgggacaactgctatacatac
agggaggcagccaaggcccttgcagactatgtaaagcatatgggctatacccatgtggag
cttatggggatcgcagagcacccctttgacggctcctggggctatcaggtgaccggctat
tatgctcccacctcccgctacggtgctcccaaggatttcatgtaccttgtaaattatctc
cataaaaaaggaatcggcgttattttagactgggttcccgcccattttcccagggacgcc
cacgggcttgctgattttgacggggaacccctctatgagtacgcagatccccgcaaggga
gagcatcccgactggggtacaaaggtatttgattacggaaagaacgaggtcaaaaatttc
ctgatcgccaacgccctctactggatcgagcagtaccacatagacggactgagggtggat
gcagtggcatccatgctctatctggattacggcagaaaggacggggagtgggttgccaac
cagtacggcggcaatcagaatctggaagccatcgaatttttcaagcatttaaacagtgtt
ctgacagggagaaaggacggctgcatgattatcgccgaggagtccacagcctggccgaag
gtcacgcaccggccggaggatgacggacttggctttaccttcaagtggaacatgggctgg
atgcacgatttcctggaatacatgaagctggatcccatttacaggaaatttaaccacaac
cacatgaccttcgggcttacctactccaccagtgaaaacttcatcctcgttctctcccac
gatgaggttgtccatttaaaatgctctatgatcaataagatgcccggcatctacgaggac
aaattcgccaacctgaaggcaggctacaccttcatgctgggccatcccggcaaaaagctg
ctgtttatgggacaggatttcggccagttccacgagtgggatgaaaaggtatctctggac
tggtatctggctgacgaacccctccatgcagatcttcaaagctatgtaaggggccttctc
accctctatcggaaatacccctgcctgtcccgcctggacaatgactacgcaggcttccag
tggatcaatgccaacgacgctgaccgaagcattttcagcttcgtgcgccgggatgaaacg
aagaagaaaaatctcctcttcatcatcaatttcactccggtggagagggcggattaccgg
gtaggcgtgccgaagcggggcaatttcaccctggttctggacagccatcacggatattat
gagaaaaacgatgacgtgcacgtttaccgctccaagaagggagagtgcgacggccagccc
tactccttctcttatccgcttcccccctacgggacggccgtgttccgcttttaa

DBGET integrated database retrieval system