KEGG   Butyrate-producing bacterium SM4/1: CL3_23030Help
Entry
CL3_23030         CDS       T02610                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bprm  Butyrate-producing bacterium SM4/1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bprm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CL3_23030
Enzymes [BR:bprm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CL3_23030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2016326..2017774
Genome map
AA seq 482 aa AA seqDB search
MKRESGILLPVSSLPSRYGIGCFSKEAYEFVDHLSEAGQSYWQILPLGPTSYGDSPYQSF
STFAGNPYFISLEDLIKEGVLTREECDSADFGKKQDSIDYAKLYRHRFPLLRKAYERSNI
SENREFLQFQAENRWWLRDYAIYMAVKARFEQKAWTEWAEDIRLRWDNAMDYYQRELYFD
IEFHEYLQFKFMEQWRRLKSYSNSRGIRIVGDIPIYVAMDSADTWANPQLFQLDSENRPT
AVAGCPPDGFSATGQLWGNPLYNWEYHRNTGYQWWISRLAHCYQLYDVVRIDHFRGFDEY
FSIPADADTAITGHWEKGPGIDFFHRIRQALGEKEIIAEDLGYVTDSVRWLVKETGYPGM
KVLEFAFDSRDSGCAGDYLPHNYPENCVVYTGTHDNETIFGWFHSIKQEERELARDYLCD
HYTPDKKLHLAFISLAMRSQARMCIIPLQDYMGLPNRCRINTPSTVGTNWKWRFLPEQMT
EG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgagagagcggaattttgcttcctgtttccagtctgccgtccaggtacggcatt
ggatgcttttccaaggaagcctatgagtttgtggatcatctgagtgaggcaggccagtcc
tactggcagattctgcctctggggcctaccagctacggggactcaccctaccagtctttt
tctacctttgcaggcaatccctatttcatcagcctggaggatctgattaaggagggagtc
ctcaccagggaggagtgcgacagcgcagattttggaaaaaagcaggacagcattgattat
gcaaagctgtacagacaccgtttccctcttctcagaaaagcctatgagaggagcaatatc
agcgagaacagagagtttctccagtttcaggcagaaaacaggtggtggctcagagactat
gccatctatatggcagtaaaagccagatttgagcagaaggcatggacagagtgggcggag
gatatccgcctgcgctgggacaatgccatggattactatcagagagagctctactttgat
attgagttccacgagtatctgcagtttaagtttatggagcagtggagaagactgaaaagc
tattccaacagcaggggcatccgcattgtcggagacattcccatctacgttgccatggac
agcgcagatacctgggccaatccgcagctcttccagcttgacagcgaaaacaggcccaca
gcggtggcaggatgccctcccgacggattttcagccacaggccagctgtggggaaaccct
ctttataactgggaataccacagaaataccggttatcagtggtggatcagccgtctggct
cactgctatcagctctacgacgtggtgcgcatcgatcatttccggggatttgatgagtat
ttttccataccggcagacgcagacaccgcgatcacgggacactgggagaaggggccggga
atcgactttttccacagaatccgacaggccctgggcgaaaaggagattatcgccgaagat
ctgggctatgtgacggactctgtgcgctggctggtaaaggagacgggttatccgggaatg
aaggtgctggagtttgccttcgattccagggattccggctgcgccggcgattaccttccc
cacaattacccggaaaactgcgtggtctacacgggaactcacgacaatgagaccatcttc
ggctggttccactccatcaagcaggaggagagggagctggccagagattacctgtgcgat
cactacacgccggataaaaaactccacctggcctttatcagtctcgccatgcgaagccag
gccagaatgtgcatcattcctcttcaggattacatgggacttcccaaccgatgccggatc
aatacgccctccacagtggggacaaactggaaatggcgctttctgccggagcagatgaca
gagggctga

DBGET integrated database retrieval system