KEGG   Butyrate-producing bacterium SM4/1: CL3_23380Help
Entry
CL3_23380         CDS       T02610                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bprm  Butyrate-producing bacterium SM4/1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bprm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CL3_23380
Enzymes [BR:bprm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CL3_23380
Exosome [BR:bprm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CL3_23380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2050733..2053492
Genome map
AA seq 919 aa AA seqDB search
MDKVLYDLMDWAGIEELVYSESSDPHRMLGAHLTEQGMLVQAFIPTARDITVKLSATGKT
YPMEMADEAGFFAVLIPRKTLADYTLQVFYDNGTLGEIRDPYSFAPQFTENDLKKFEAGI
HYSIYEKMGAHPMTVKGVEGVYFAVWAPCAMRVSVVGDFNFWDGRRHQMRKLGDSGIFEL
FIPGLKKGTIYKYEIKFRNGDPALKADPYANYAELRPNTASIVWDLGKYEWNDGDWMKQR
AAADSKDRPMSVYEVHLGSWKRKEFSLDEHGDEIPGSEFYNYREIAPELAAYVKDMGYTH
VELMPVMEHPLDASWGYQVTGYYAPTSRYGTPDDFMYFMDYMHGQGIGVILDWVPAHFPR
DAWGMAQFDGTCVYEHQDPRQGSHPHWGTLIYNYGRPGVSNFLIANAMFWADKYHADGIR
FDAVASMLYLDYGKNPGEWVANIYGGHENLEAVEFLKHLNSVFKGRKDGAVLIAEESTAW
PKVTGPVKEDGLGFDYKWNMGWMNDFLGYMKCDPYFRCHHYGELTFSMIYAYSEDFILVF
SHDEVVHGKGSMAGKMPGDTFEAKFANLRAAYGFMMGHPGKKLLFMGQEFGQIDEWNENK
SLEWELLQYPIHRNMQTYVKALNHFYREHPALYKEDYTPDGFEWINCMDSANNIVVFLRK
TGKPEETLLFVCNFAPVEHQKYQIGVPFAGKYKEIFNSESQEFGGSGVVNPRVKTSKEEE
HDGRENSITVRVAPLGVSVFSCTPDEKKSAKTSAAGRKAKSAKSRAGAENSKKTAGRKKG
SKTPETAFSVNEESASEGRGDSGDEKEPSRGQVITFKAEKSLYGALADLKDDEEAREKLK
KEMEGSRTESEKQSESVVRKAKKAQKAARKKAQEAADTLIATVNGVKRAAREKIESVQEP
DKREKPKHPDKKAEQPKKE
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagtattatacgatcttatggactgggcaggcattgaggagctggtgtactct
gaatcttccgatcctcaccggatgctgggggcgcatctgacagagcaggggatgctggtg
caggcgtttatacccacagccagagacattacagtaaagctctcagccacgggaaaaacc
tatcccatggagatggcagatgaggctggttttttcgctgtgctgattccgagaaagaca
ctggccgactatacgctgcaggtgttctatgacaatgggacgctgggggagatccgcgat
ccatattcctttgcgcctcagttcacagaaaatgatttaaagaaattcgaagcaggaatc
cactattccatctatgaaaaaatgggagcgcacccgatgacagtaaaaggcgtggaggga
gtttacttcgccgtgtgggcgccctgtgccatgcgcgtcagcgtggttggggattttaac
ttctgggatgggcgccgccaccagatgagaaagctgggggattccggtatctttgaactc
tttatcccgggccttaagaagggaaccatttataagtatgagatcaaattcagaaacggg
gatccggctctgaaggcggatccatatgcaaactatgcagaacttcgtccgaatactgcg
tctattgtatgggatctgggaaaatatgagtggaatgacggggactggatgaagcagagg
gcagccgccgacagcaaggacaggcccatgtctgtctatgaggtgcatctgggctcctgg
aagagaaaggagttctctctggacgagcatggcgatgagataccaggctctgagttctat
aattaccgcgagattgcaccggaactggcggcctatgtgaaggacatgggctatactcat
gtggagctgatgccggtgatggagcaccctctggatgcgtcctggggataccaggtgact
ggctattatgcgcctaccagccgctacggcaccccggatgattttatgtattttatggat
tacatgcacggtcaggggatcggcgtgattctggactgggttccggcccattttccgcgg
gatgcctggggaatggcccagtttgacggcacctgcgtctatgagcaccaggatccgagg
cagggctctcacccacactggggaactctgatctacaattacggccgtcccggggtatcc
aatttcctgattgccaatgccatgttctgggcagacaagtatcacgctgacggaatccgc
ttcgatgcggtggcatccatgctctatctggactatggaaagaacccgggagagtgggtg
gcaaatatttacggaggccatgagaatctggaggctgtggaatttttaaagcatttaaac
tctgtgttcaagggaaggaaggacggcgctgtgctgattgccgaggaatccacagcctgg
ccgaaggtgacaggtcctgtgaaggaggacggccttggctttgactataagtggaatatg
gggtggatgaacgacttcctcggatacatgaagtgcgatccctacttccgctgccaccat
tacggggagctgaccttcagcatgatttatgcctacagcgaggatttcatcctggtattc
tcccacgacgaggtggtccacggcaagggctccatggcgggaaagatgccgggagatacc
tttgaggcaaagtttgcgaaccttcgggctgcctacggctttatgatgggtcatccgggc
aagaagctcctgtttatgggacaggagttcggccagattgacgagtggaatgaaaataag
agccttgagtgggagcttctgcagtatccgattcacagaaacatgcagacctatgtaaaa
gccctcaatcacttctacagagagcatccggccctttacaaagaggattacacgccggac
ggcttcgagtggattaactgcatggattcagcaaataatattgtagtctttctcagaaag
acgggaaagccggaggaaacgctgctctttgtctgcaactttgcgcctgtagagcatcag
aaataccagatcggcgtgccgtttgcaggaaagtacaaggagattttcaacagtgagtcc
caggaattcggcggttcaggagtggttaacccgcgggtgaagacctcaaaggaggaggaa
cacgacggaagggagaattcgatcactgtgcgcgtcgctcctctgggtgtcagtgtgttc
tcgtgcacaccggatgagaaaaagagcgcgaagacatctgcggcaggcagaaaggcgaaa
tctgcaaagagcagggcaggagcagagaactcgaagaaaacggcaggacggaaaaagggt
tccaaaacaccagagacggccttctctgtaaatgaagagagcgcttctgaaggcagaggg
gattccggtgacgaaaaggagccttccaggggacaggtgattacatttaaggcagaaaag
agcctgtacggcgccctggcagatttgaaggatgacgaggaggccagggagaagctcaaa
aaagagatggagggcagccggacggaatcagaaaagcagtccgagagtgtagtgaggaag
gcaaaaaaggctcagaaggcggccagaaagaaagcccaggaggcggcagataccctgatt
gcaactgtaaatggggtaaagagggcagccagagagaagatagagagtgttcaggagccg
gacaagagagaaaaaccaaagcatcctgacaaaaaagcagagcagcctaagaaagaataa

DBGET integrated database retrieval system