KEGG   Butyrate-producing bacterium SM4/1: CL3_25100Help
Entry
CL3_25100         CDS       T02610                                 

Definition
Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bprm  Butyrate-producing bacterium SM4/1
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:bprm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CL3_25100
  Lipid metabolism
   00561 Glycerolipid metabolism
    CL3_25100
   00600 Sphingolipid metabolism
    CL3_25100
Enzymes [BR:bprm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CL3_25100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2196110..2196385)
Genome map
AA seq 91 aa AA seqDB search
MNKITFMGAGSTVFVRNVLGDCMCTQSLRDWEFALYDIDPVRLQESFEIISAMNRTKGGH
GKVTAYLGVENRKEALRGGPIRNQRHPSGPL
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgaataagatcacttttatgggcgcaggcagcaccgtgtttgtccgcaatgtgctggga
gactgcatgtgtacccaatccctccgggactgggaattcgctctgtacgacatcgatccc
gtccgcttgcaggagagctttgagatcatctccgccatgaacaggaccaagggcggacac
gggaaggtcaccgcctatctgggagttgaaaatcggaaggaagccctccgagggggcccg
attcgtaatcaacgccatccaagtgggcctctatga

DBGET integrated database retrieval system