KEGG   Butyrate-producing bacterium SM4/1: CL3_26750Help
Entry
CL3_26750         CDS       T02610                                 

Definition
Uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bprm  Butyrate-producing bacterium SM4/1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bprm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CL3_26750
Enzymes [BR:bprm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CL3_26750
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CL3_26750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2328732..2329700
Genome map
AA seq 322 aa AA seqDB search
MDYSALAREGGTLIFLMGVTSAETICRGLIEGGMDRHTPAALLEKGTTAGQRRVLSTLER
LWEDGKSQNIKPPAIIVVGEVCSLSESLQWMEEKPLFGAKILVTRPKRRSAGMAGRLREA
GAEVVELPAAEPRLLEDTSFLDRTLERLADFRWAVFTSPSGVELFFEYLRREKKDIRLLM
GLKFAVIGAGTAKALCRYGFYADYMPENFYAKELGRGLAETILHEMKEEEKRGENGRGGA
GCGKPVKVLLLRAQKASPALCEELARAEIPFEDAVLYRTEFPAPSMQAERVKILLEKKAF
DYVTFTSESTVKGFLELLSPTD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggattacagtgccctggcccgcgaagggggaactctcatttttcttatgggagtcacc
tcagcggagacgatctgccggggactcatcgagggaggaatggacagacacacccctgcc
gctcttctggaaaaaggcaccacggccgggcagaggagggtgctctcgactctggaaagg
ctgtgggaggatggaaaaagccagaatatcaagccgcctgccattattgtggtgggagaa
gtgtgcagcctctccgagagcctgcagtggatggaggaaaaacctctgtttggcgcgaag
atactggtgacgcgcccgaaaagacgttccgccgggatggccggcaggctgagggaggca
ggggcggaggttgtggagcttccggcggcagagccgaggcttctggaggatacctctttc
cttgaccgtactctggaaagactggcggactttagatgggcagtttttacaagtcccagc
ggagtggaactgttttttgagtatctgagaagagagaaaaaggacatccgcctcctgatg
gggcttaaatttgccgtaatcggagcgggaacggcaaaggccctctgcaggtacggattt
tatgcagactacatgccggagaacttttatgcgaaggaactgggcagagggcttgcagaa
actatcctccatgagatgaaagaggaggagaaaaggggagaaaatggcagaggaggggcc
ggatgcggaaaacctgtgaaggttcttctgctgcgggcccagaaagcgtcgcctgctctc
tgtgaggagcttgccagggcagaaattccatttgaggacgcggtgctttaccgcacggaa
tttccagccccgtctatgcaggcggagagggtaaagatcctgctggagaaaaaagccttt
gactacgttaccttcacaagtgagtccactgtgaagggctttcttgaacttctctccccc
accgattag

DBGET integrated database retrieval system