KEGG   Butyrate-producing bacterium SM4/1: CL3_29160Help
Entry
CL3_29160         CDS       T02610                                 

Definition
Sugar kinases, ribokinase family (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bprm  Butyrate-producing bacterium SM4/1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bprm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CL3_29160
Enzymes [BR:bprm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CL3_29160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2545710..2546624)
Genome map
AA seq 304 aa AA seqDB search
MKVLNFGSLNIDYVYSLDHFVQKGETISSERLDIFSGGKGLNQSVALGRAGAEVYHAGAI
GQDGEFLIELLCEAGVRTEFVRRLESVRTGNAIIQRDKAGDNCIILYGGANQNIERTQVD
ETIGFFEAGDYIVLQNEINEMAYIMEKAHEKGMKIVLNPSPMDEKILALPLSFVDLFILN
EIEACQLLGLSREERRDAASRGEELLRKLSERFPQAMIVLTLGEMGSVCMDGQETVKQPI
YKTRTVDTTAAGDTFTGYFVSGLMRGLSVKESMDLASRAAAITVSGLGAAPSIPALVQVM
EREF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtactgaattttggatcgctgaatattgattatgtgtacagcctggatcacttc
gtgcagaagggagagacgatctcctcagagcggctcgatatattcagcggaggaaaggga
ttgaaccagtccgtggctctggggagagcgggggccgaggtgtaccacgcgggagcaatc
ggacaggacggagaattcctcatagagcttctctgcgaggctggagtcaggacggaattt
gtcagaaggcttgaatccgtccgcacgggaaatgccattatacagagagataaggcagga
gataactgcattatcctctacggcggggcgaaccagaacattgagcggacacaggtagat
gagaccattggcttttttgaggcaggggattacattgtgctgcaaaatgagatcaatgag
atggcctacattatggaaaaggcccatgagaagggtatgaaaattgtgctgaacccttcg
cccatggatgaaaaaattctcgctctccccctctccttcgtagatctgtttattctgaat
gagattgaggcctgccagcttctcgggctttcccgggaggagagaagggatgccgcatcc
agaggggaggagcttttaagaaaactctctgagcggttcccacaggcgatgatcgttctg
acgctgggagagatggggtcggtctgcatggacgggcaggagacggtgaaacagcccatc
tacaaaaccaggacagtggataccacagcggcaggagatacgtttacaggatattttgtg
tccggtctgatgcgggggctttctgtgaaggagtccatggatctggcttccagggctgcg
gcgattacagtgtccggcctgggggcagctccgtccattccagcccttgtacaggtgatg
gagagggagttttag

DBGET integrated database retrieval system